Overview

  • Product name

  • Description

    Rabbit polyclonal to GPR83
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human GPR83 aa 349-423.
    Sequence:

    NENFRIELKALLSMCQRPPKPQEDRPPSPVPSFRVAWTEKNDGQRAPLAN NLLPTSQLQSGKTDLSSVEPIVTMS


    Database link: Q9NYM4

  • Positive control

    • WB: LO2 whole cell lysate. ICC/IF: HeLa cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab237610 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/1000 - 1/5000. Predicted molecular weight: 48 kDa.
ICC/IF 1/50 - 1/200.

Target

  • Function

    Orphan receptor. Could be a neuropeptide Y receptor.
  • Tissue specificity

    Brain specific.
  • Sequence similarities

    Belongs to the G-protein coupled receptor 1 family.
  • Cellular localization

    Cell membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • G protein coupled receptor 72 antibody
    • G protein coupled receptor 83 antibody
    • G-protein coupled receptor 72 antibody
    • GIR antibody
    • Glucocorticoid induced receptor antibody
    • GPR 72 antibody
    • GPR 83 antibody
    • GPR72 antibody
    • Gpr83 antibody
    • GPR83_HUMAN antibody
    • Probable G-protein coupled receptor 83 antibody
    see all

Images

  • Anti-GPR83 antibody (ab237610) at 1/1000 dilution + LO2 (Human immortal liver cell line) whole cell lysate

    Secondary
    Goat polyclonal to rabbit IgG at 1/10000 dilution

    Predicted band size: 48 kDa

  • HeLa (Human epithelial cell line from cervix adenocarcinoma) cells stained for GPR83 (green) using ab237610 at 1/100 dilution in ICC/IF. Secondary antibody is an Alexa-Fluor® 488-conjugated Goat Anti-Rabbit IgG (H+L).

References

ab237610 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab237610.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up