Overview

  • Product name

  • Description

    Rabbit polyclonal to GPRC5A
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Synthetic peptide corresponding to Human GPRC5A aa 1-45 (N terminal).
    Sequence:

    MATTVPDGCRNGLKSKYYRLCDKAEAWGIVLETVATAGVVTSVAF


    Database link: Q8NFJ5

  • Positive control

    • 293T, A431, H1299, HeLa, HepG2, Molt-4 and Raji cell lysates; CAL27 xenograft tissue.
  • General notes

     This product was previously labelled as RAI3

     

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.00
    Preservative: 0.01% Thimerosal (merthiolate)
    Constituents: 1.21% Tris, 0.75% Glycine, 20% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab155557 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/3000. Predicted molecular weight: 40 kDa.
IHC-P 1/100 - 1/1000. Perform heat mediated antigen retrieval before commencing with IHC staining protocol using 10mM Citrate buffer (pH6.0) or Tris-EDTA buffer (pH8.0).

Target

  • Function

    Unknown. This G-protein coupled receptor could be involved in modulating differentiation and maintaining homeostasis of epithelial cells. The comparable expression level in fetal lung and kidney with adult tissues suggests a possible role in embryonic development and maturation of these organs. This retinoic acid-inducible GPCR provide evidence for a possible interaction between retinoid and G-protein signaling pathways.
  • Tissue specificity

    Expressed at high level in fetal and adult lung tissues. Constitutively expressed in fetal kidney and adult placenta, kidney, prostate, testis, ovary, small intestine, colon, stomach, and spinal chord at low to moderate levels. Not detectable in fetal heart, brain, and liver and adult heart, brain, liver, skeletal muscle, pancreas, spleen, thymus, and peripheral leukocytes. According to PubMed:10783259, expressed at low but detectable level in pancreas and heart.
  • Sequence similarities

    Belongs to the G-protein coupled receptor 3 family.
  • Cellular localization

    Cell membrane. Cytoplasmic vesicle membrane. Localized in the plasma membrane and perinuclear vesicles.
  • Information by UniProt
  • Database links

  • Alternative names

    • G protein coupled receptor family C group 5 member A antibody
    • G-protein coupled receptor family C group 5 member A antibody
    • GPCR 5A antibody
    • GPCR5A antibody
    • Gprc 5a antibody
    • Gprc5a antibody
    • Orphan G protein coupling receptor PEIG 1 antibody
    • Orphan G protein coupling receptor PEIG1 antibody
    • Orphan G-protein-coupling receptor PEIG-1 antibody
    • RAI 3 antibody
    • RAI3_HUMAN antibody
    • Raig 1 antibody
    • RAIG-1 antibody
    • Raig1 antibody
    • Retinoic acid induced 3 antibody
    • Retinoic acid induced gene 1 protein antibody
    • Retinoic acid induced protein 3 antibody
    • Retinoic acid responsive antibody
    • Retinoic acid responsive gene antibody
    • Retinoic acid-induced gene 1 protein antibody
    • Retinoic acid-induced protein 3 antibody
    see all

Images

  • All lanes : Anti-GPRC5A antibody (ab155557) at 1/1000 dilution

    Lane 1 : HeLa cell lysate
    Lane 2 : HepG2 cell lysate

    Lysates/proteins at 30 µg per lane.

    Secondary
    All lanes : HRP-conjugated anti-rabbit IgG antibody

    Predicted band size: 40 kDa

  • All lanes : Anti-GPRC5A antibody (ab155557) at 1/1000 dilution

    Lane 1 : H1299 whole cell lysate
    Lane 2 : HeLa whole cell lysate
    Lane 3 : HepG2 whole cell lysate

    Lysates/proteins at 30 µg per lane.

    Predicted band size: 40 kDa



    10% SDS PAGE
  • Immunohistochemical analysis of paraffin-embedded Human CAL27 xenograft tissue labeling GPRC5A with ab155557 at 1/100 dilution.

References

This product has been referenced in:

  • Lee CH  et al. Discovery of a diagnostic biomarker for colon cancer through proteomic profiling of small extracellular vesicles. BMC Cancer 18:1058 (2018). Read more (PubMed: 30382917) »
See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab155557.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up