Overview

  • Product name

  • Description

    Rabbit polyclonal to GPRC6A
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Horse, Saccharomyces cerevisiae
  • Immunogen

    Synthetic peptide corresponding to Human GPRC6A aa 702-751 (C terminal).
    Sequence:

    NVTMTNPSSSGKSATWQKSKDLQAQAFAHICRENATSVSKTLPRKRMSSI


    Database link: AAS13466

  • Positive control

    • Jurkat cell lysate
  • General notes

    Previously labelled as GPCR6A. 

Properties

Applications

Our Abpromise guarantee covers the use of ab128661 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 85 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • Function

    Receptor activated by amino acids with a preference for basic amino acids such as L-Lys, L-Arg and L-ornithine but also by small and polar amino acids. The L-alpha amino acids respond is augmented by divalent cations Ca(2+) and Mg(2+). Activated by extracellular calcium and osteocalin. Seems to act through a G(q)/G(11) and G(i)-coupled pathway. Mediates the non-genomic effects of androgens in multiple tissue. May coordinates nutritionnal and hormonal anabolic signals through the sensing of extracellular amino acids, osteocalcin, divalents ions and its responsiveness to anabolic steroids.
  • Tissue specificity

    Isoform 1 is expressed at high level in brain, skeletal muscle, testis, bone, calvaria, osteoblasts and leukocytes. Expressed at intermediate level in liver, heart, kidney and spleen. Expressed at low level in lung, pancreas, placenta and ovary. Not detected in thymus, prostate, small intestine, tongue and colon. Isoform 1 and isoform 2 are expressed in kidney at the same level. Isoform 2 is expressed at lower level than isoform 1 in the other tissues.
  • Sequence similarities

    Belongs to the G-protein coupled receptor 3 family.
  • Post-translational
    modifications

    N-glycosylated.
  • Cellular localization

    Cell membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • bA86F4.3 antibody
    • G protein coupled receptor 33 antibody
    • G protein coupled receptor family C group 6 member A antibody
    • G-protein coupled receptor family C group 6 member A antibody
    • G-protein coupled receptor GPCR33 antibody
    • GPC6A_HUMAN antibody
    • GPCR 33 antibody
    • GPCR 6A antibody
    • GPCR antibody
    • GPCR33 antibody
    • GPCR6A antibody
    • GPR C6A antibody
    • GPRC 6A antibody
    • gprc6a antibody
    • hGPCR 33 antibody
    • hGPCR33 antibody
    • hGPRC6A antibody
    • OTTHUMP00000017075 antibody
    • Predicted with SOSUI analysis antibody
    • seven transmembrane helix receptor antibody
    see all

Images

  • Anti-GPRC6A antibody (ab128661) at 1 µg/ml + Jurkat lysate at 10 µg

    Predicted band size: 85 kDa



    Gel concentration 6-18%

References

ab128661 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab128661.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up