Overview

  • Product name

    Anti-GPSM1 antibody
  • Description

    Rabbit polyclonal to GPSM1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Rat
  • Immunogen

    Recombinant fragment corresponding to Human GPSM1 aa 387-454.
    Sequence:

    SPAASEKPDLAGYEAQGARPKRTQRLSAETWDLLRLPLEREQNGDSHHSG DWRGPSRDSLPLPVRSRK


    Database link: Q86YR5

  • Positive control

    • IHC-P: Human stomach (lower) tissue. ICC/IF: A431 cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab243516 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

Target

  • Function

    Guanine nucleotide dissociation inhibitor (GDI) which functions as a receptor-independent activator of heterotrimeric G-protein signaling. Keeps G(i/o) alpha subunit in its GDP-bound form thus uncoupling heterotrimeric G-proteins signaling from G protein-coupled receptors. Controls spindle orientation and asymmetric cell fate of cerebral cortical progenitors. May also be involved in macroautophagy in intestinal cells. May play a role in drug addiction.
  • Tissue specificity

    Expressed in intestinal cells.
  • Sequence similarities

    Belongs to the GPSM family.
    Contains 4 GoLoco domains.
    Contains 9 TPR repeats.
  • Domain

    The GoLoco domains mediate interaction with G(i/o) alpha (By similarity). The GoLoco domains are essential for the GDI activity toward G(i/o) alpha.
  • Post-translational
    modifications

    Phosphorylation regulates interaction with G(i/o) alpha.
  • Cellular localization

    Cytoplasm > cytosol. Endoplasmic reticulum membrane. Golgi apparatus membrane. Cell membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • Activator of G-protein signaling 3 antibody
    • AGS3 antibody
    • AGS3 homolog antibody
    • C10a antibody
    • G protein signaling modulator 1 (AGS3 like, C. elegans) antibody
    • G-protein-signaling modulator 1 antibody
    • GPSM1 antibody
    • GPSM1_HUMAN antibody
    see all

Images

  • Paraffin-embedded human stomach (lower) tissue stained for GPSM1 using ab243516 at 1/200 dilution in immunohistochemical analysis.

  • PFA-fixed, Triton X-100 permeabilized A431 (human epidermoid carcinoma cell line) cells stained for GPSM1 (green) using ab243516 at 4 µg/ml in ICC/IF.

References

ab243516 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab243516.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up