Overview

  • Product name

  • Description

    Rabbit polyclonal to GPT2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human, Pig
    Predicted to work with: Mouse
  • Immunogen

    Recombinant fragment (His-tag) corresponding to Human GPT2 aa 210-300. Expressed in E.coli. N-terminal tag.
    Sequence:

    MIPIPQYPLYSAVISELDAIQVNYYLDEENCWALNVNELRRAVQEAKDHC DPKVLCIINPGNPTGQVQSRKCIEDVIHFAWEEKLFLLADE


    Database link: Q8TD30

  • Positive control

    • WB: Recombinant human GPT2 protein; Human liver lysate; HepG2 and HEK-293T cell lysates; Pig skeletal muscle lysate. IHC-P: Human kidney tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab232963 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 58 kDa.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

  • Function

    Catalyzes the reversible transamination between alanine and 2-oxoglutarate to form pyruvate and glutamate.
  • Tissue specificity

    Expressed at high levels in muscle, adipose tissue, kidney and brain and at lower levels in the liver and breast.
  • Pathway

    Amino-acid degradation; L-alanine degradation via transaminase pathway; pyruvate from L-alanine: step 1/1.
  • Sequence similarities

    Belongs to the class-I pyridoxal-phosphate-dependent aminotransferase family. Alanine aminotransferase subfamily.
  • Information by UniProt
  • Database links

  • Alternative names

    • AAT2 antibody
    • Alanine aminotransferase 2 antibody
    • ALAT2_HUMAN antibody
    • ALT2 antibody
    • Glutamate pyruvate transaminase 2 antibody
    • Glutamic alanine transaminase 2 antibody
    • Glutamic pyruvate transaminase (alanine aminotransferase) 2 antibody
    • Glutamic pyruvic transaminase 2 antibody
    • Glutamic--alanine transaminase 2 antibody
    • Glutamic--pyruvic transaminase 2 antibody
    • GPT 2 antibody
    • gpt2 antibody
    see all

Images

  • Formalin-fixed, paraffin-embedded human kidney tissue stained for GPT2 using ab232963 at 20 μg/ml in immunohistochemical analysis. DAB staining.

  • Anti-GPT2 antibody (ab232963) at 1 µg/ml + Human liver lysate

    Secondary
    HRP-Linked Goat anti-Rabbit IgG polyclonal at 0.2 µg/ml

    Predicted band size: 58 kDa

  • Anti-GPT2 antibody (ab232963) at 1 µg/ml + HepG2 (human liver hepatocellular carcinoma cell line) cell lysate

    Secondary
    HRP-Linked Goat anti-Rabbit IgG polyclonal at 0.2 µg/ml

    Predicted band size: 58 kDa

  • Anti-GPT2 antibody (ab232963) at 1 µg/ml + HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) cell lysate

    Secondary
    HRP-Linked Goat anti-Rabbit IgG polyclonal at 0.2 µg/ml

    Predicted band size: 58 kDa

  • Anti-GPT2 antibody (ab232963) at 2 µg/ml + Pig skeletal muscle lysate

    Secondary
    HRP-Linked Goat anti-Rabbit IgG polyclonal at 0.2 µg/ml

    Predicted band size: 58 kDa

  • Anti-GPT2 antibody (ab232963) at 2 µg/ml + Recombinant human GPT2 protein

    Predicted band size: 58 kDa

References

ab232963 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab232963.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up