Anti-GRAF antibody (ab238883)
Key features and details
- Rabbit polyclonal to GRAF
- Suitable for: IHC-P
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-GRAF antibody
See all GRAF primary antibodies -
Description
Rabbit polyclonal to GRAF -
Host species
Rabbit -
Tested applications
Suitable for: IHC-Pmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Mouse -
Immunogen
Recombinant fragment corresponding to Human GRAF aa 625-814.
Sequence:ESVSSNPNSILNSSSSLQPNMNSSDPDLAVVKPTRPNSLPPNPSPTSPLS PSWPMFSAPSSPMPTSSTSSDSSPVRSVAGFVWFSVAAVVLSLARSSLHA VFSLLVNFVPCHPNLHLLFDRPEEAVHEDSSTPFRKAKALYACKAEHDSE LSFTAGTVFDNVHPSQEPGWLEGTLNGKTGLIPENYVEFL
Database link: Q9UNA1-1 -
Positive control
- IHC-P: Human breast cancer and colon cancer tissue.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.30
Preservative: 0.02% Sodium azide
Constituents: 50% Glycerol (glycerin, glycerine), PBS -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
Applications
Our Abpromise guarantee covers the use of ab238883 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
IHC-P | 1/20 - 1/200. |
Target
-
Function
GTPase-activating protein for RHOA and CDC42. -
Involvement in disease
Defects in ARHGAP26 are a cause of juvenile myelomonocytic leukemia (JMML) [MIM:607785]. JMML is a pediatric myelodysplastic syndrome that constitutes approximately 30% of childhood cases of myelodysplastic syndrome (MDS) and 2% of leukemia. Chromosomal translocation t(5;11)(q31;q23) with MLL has been found in a JMML patient. -
Sequence similarities
Contains 1 PH domain.
Contains 1 Rho-GAP domain.
Contains 1 SH3 domain. -
Cellular localization
Cell junction > focal adhesion. Cytoplasm > cytoskeleton. Colocalizes with actin stress fibers and cortical actin structures. - Information by UniProt
-
Database links
- Entrez Gene: 23092 Human
- Entrez Gene: 71302 Mouse
- Omim: 605370 Human
- SwissProt: Q9UNA1 Human
- SwissProt: Q6ZQ82 Mouse
- Unigene: 654668 Human
- Unigene: 329396 Mouse
-
Alternative names
- arhgap26 antibody
- FLJ42530 antibody
- GRAF antibody
see all
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-GRAF antibody (ab238883)
Paraffin-embedded human breast cancer tissue stained for GRAF with ab238883 at a 1/100 dilution in immunohistochemical analysis.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-GRAF antibody (ab238883)
Paraffin-embedded human colon cancer tissue stained for GRAF with ab238883 at a 1/100 dilution in immunohistochemical analysis.
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab238883 has not yet been referenced specifically in any publications.