Overview

  • Product name

    Anti-GRAMD4 antibody
  • Description

    Rabbit polyclonal to GRAMD4
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse, Human
  • Immunogen

    Recombinant fragment corresponding to Human GRAMD4 aa 23-161.
    Sequence:

    ESPNASDTECSDEIPLKVPRTSPRDSEELRDPAGPGTLIMATGVQDFNRT EFDRLNEIKGHLEIALLEKHFLQEELRKLREETNAEMLRQELDRERQRRM ELEQKVQEVLKARTEEQMAQQPPKGQAQASNGAERRSQG


    Database link: Q6IC98-1

  • Positive control

    • WB: Mouse brain tissue lysate; MCF whole cell lysate. IHC-P: Human breast cancer tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab234649 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.
WB 1/500 - 1/5000. Predicted molecular weight: 66 kDa.

Target

Images

  • Anti-GRAMD4 antibody (ab234649) at 1/500 dilution + Mouse brain tissue lysate

    Secondary
    Goat polyclonal to rabbit IgG at 1/50000 dilution

    Predicted band size: 66 kDa

  • Paraffin-embedded human breast cancer tissue stained for GRAMD4 using ab234649 at 1/100 dilution in immunohistochemical analysis.

  • Anti-GRAMD4 antibody (ab234649) at 1/500 dilution + MCF7 (human breast adenocarcinoma cell line) whole cell lysate

    Secondary
    Goat polyclonal to rabbit IgG at 1/50000 dilution

    Predicted band size: 66 kDa

References

ab234649 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab234649.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up