Overview

  • Product name

  • Description

    Rabbit polyclonal to Grancalcin
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Orangutan
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Human Grancalcin aa 1-139. (Expressed in E.coli).
    Sequence:

    MAYPGYGGGFGNFSIQVPGMQMGQPVPETGPAILLDGYSGPAYSDTYSSA GDSVYTYFSAVAGQDGEVDAEELQRCLTQSGINGTYSPFSLETCRIMIAM LDRDHTGKMGFNAFKELWAALNAWKENFMTVDQDGSGTV


    Database link: P28676

  • Positive control

    • IHC-P: Human cerebrum, glioma, kidney, stomach, prostate cancer and liver tissues. WB: Human serum, HL60 and Sp2/0 cell lysates; Rat spleen lysate; Recombinant human Grancalcin protein.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    ab231632 was purified by antigen-specific affinity chromatography followed by Protein A affinity chromatography.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab231632 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 - 20 µg/ml.
WB Use a concentration of 0.5 - 2 µg/ml. Predicted molecular weight: 24 kDa.

Target

  • Relevance

    Grancalcin is a calcium binding protein abundant in neutrophils and macrophages. It belongs to the penta EF hand subfamily of proteins which includes sorcin, calpain, and ALG2. Grancalcin localization is dependent upon calcium and magnesium. In the absence of divalent cation, grancalcin localizes to the cytosolic fraction; with magnesium alone, it partitions with the granule fraction; and in the presence of magnesium and calcium, it associates with both the granule and membrane fractions, suggesting a role for grancalcin in granule membrane fusion and degranulation.
  • Cellular localization

    50% cytoplasmic, the remainder being attached to the membranes and granules.
  • Database links

  • Alternative names

    • GCA antibody
    • GCL antibody

Images

  • Paraffin-embedded human cerebrum tissue stained for Grancalcin using ab231632 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded human glioma tissue stained for Grancalcin using ab231632 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded human kidney tissue stained for Grancalcin using ab231632 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded human stomach tissue stained for Grancalcin using ab231632 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded human prostate cancer tissue stained for Grancalcin using ab231632 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded human liver tissue stained for Grancalcin using ab231632 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Anti-Grancalcin antibody (ab231632) at 1 µg/ml + Recombinant human Grancalcin protein

    Secondary
    HRP-Linked Guinea pig Anti-Rabbit at 1/2000 dilution

    Predicted band size: 24 kDa

  • All lanes : Anti-Grancalcin antibody (ab231632) at 1 µg/ml

    Lane 1 : Human serum
    Lane 2 : HL-60 (human promyelocytic leukemia cell line) cell lysate
    Lane 3 : Sp2/0 cell lysate
    Lane 4 : Rat spleen lysate

    Secondary
    All lanes : HRP-Linked Guinea pig Anti-Rabbit at 1/2000 dilution

    Predicted band size: 24 kDa

References

ab231632 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231632.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up