Overview

  • Product name

  • Description

    Rabbit polyclonal to Granzyme M
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human Granzyme M aa 98-243.
    Sequence:

    QHPRYKPVPALENDLALLQLDGKVKPSRTIRPLALPSKRQVVAAGTRCSM AGWGLTHQGGRLSRVLRELDLQVLDTRMCNNSRFWNGSLSPSMVCLAADS KDQAPCKGDSGGPLVCGKGRVLARVLSFSSRVCTDIFKPPVATAVA


    Database link: P51124

  • Positive control

    • IHC-P: Human lung tissue. ICC/IF: MCF7 cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab234746 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.
ICC/IF 1/50 - 1/200.

Target

  • Function

    Cleaves peptide substrates after methionine, leucine, and norleucine. Physiological substrates include EZR, alpha-tubulins and the apoptosis inhibitor BIRC5/Survivin. Promotes caspase activation and subsequent apoptosis of target cells.
  • Tissue specificity

    Highly and constitutively expressed in activated natural killer (NK) cells.
  • Sequence similarities

    Belongs to the peptidase S1 family. Granzyme subfamily.
    Contains 1 peptidase S1 domain.
  • Cellular localization

    Secreted. Cytoplasmic granule. Granules of large granular lymphocytes.
  • Information by UniProt
  • Database links

  • Alternative names

    • GRAM_HUMAN antibody
    • Granzyme M (lymphocyte met ase 1) antibody
    • Granzyme M antibody
    • GranzymeM antibody
    • GZM M antibody
    • Gzmm antibody
    • HU Met 1 antibody
    • HU-Met-1 antibody
    • LMET 1 antibody
    • LMET1 antibody
    • Lymphocyte met ase 1 antibody
    • MET 1 antibody
    • Met 1 serine protease antibody
    • Met ase antibody
    • Met-1 serine protease antibody
    • Met-ase antibody
    • MET1 antibody
    • Met1 serine protease antibody
    • Natural killer cell granular protease antibody
    see all

Images

  • MCF7 (human breast adenocarcinoma cell line) cells labeling Granzyme M (green) using ab234746 at 1/100 dilution in ICC/IF analysis. Secondary antibody is Alexa Fluor® 488-congugated AffiniPure Goat Anti-Rabbit IgG(H+L).

  • Paraffin-embedded human lung tissue stained for Granzyme M using ab234746 at 1/100 dilution in immunohistochemical analysis.

References

ab234746 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab234746.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up