Overview

  • Product name

  • Description

    Rabbit polyclonal to GRASP65
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human GRASP65 aa 221-440.
    Sequence:

    ALPLGAPPPDALPPGPTPEDSPSLETGSRQSDYMEALLQAPGSSMEDPLP GPGSPSHSAPDPDGLPHFMETPLQPPPPVQRVMDPGFLDVSGISLLDNSN ASVWPSLPSSTELTTTAVSTSGPEDICSSSSSHERGGEATWSGSEFEVSF LDSPGAQAQADHLPQLTLPDSLTSAASPEDGLSAELLEAQAEEEPASTEG LDTGTEAEGLDSQAQISTTE


    Database link: Q9BQQ3

  • Positive control

    • IHC-P: Human colon cancer and kidney tissues.

Properties

Applications

Our Abpromise guarantee covers the use of ab238489 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.

Target

  • Function

    Stacking factor involved in the postmitotic assembly of Golgi stacks from mitotic Golgi fragments. Key structural protein required for the maintenance of the Golgi apparatus integrity: its caspase-mediated cleavage is required for fragmentation of the Golgi during apoptosis. Also mediates, via its interaction with GM130, the docking of transport vesicles with the Golgi membranes.
  • Sequence similarities

    Belongs to the GORASP family.
    Contains 1 PDZ (DHR) domain.
  • Post-translational
    modifications

    Phosphorylated by CDC2/B1 and PLK kinases during mitosis. Phosphorylation cycle correlates with the cisternal stacking cycle. Phosphorylation of the homodimer prevents the association of dimers into higher order oligomers, leading to cisternal unstacking.
    Target for caspase-3 cleavage during apoptosis. The cleavage contributes to Golgi fragmentation and occurs very early in the execution phase of apoptosis.
  • Cellular localization

    Golgi apparatus > cis-Golgi network membrane. Undergoes rapid exchange with the cytosol.
  • Information by UniProt
  • Database links

  • Alternative names

    • FLJ23443 antibody
    • Golgi peripheral membrane protein p65 antibody
    • Golgi phosphoprotein 5 antibody
    • Golgi reassembly and stacking protein 1 antibody
    • Golgi reassembly and stacking protein 65 kDa antibody
    • Golgi reassembly and stacking protein, 65-kD antibody
    • Golgi reassembly stacking protein 1 65kDa antibody
    • Golgi reassembly stacking protein 1 antibody
    • Golgi reassembly stacking protein of 65 kDa antibody
    • Golgi reassembly-stacking protein 1 antibody
    • Golgi reassembly-stacking protein of 65 kDa antibody
    • GOLPH 5 antibody
    • GOLPH5 antibody
    • Gorasp 1 antibody
    • GORASP1 antibody
    • GORS1_HUMAN antibody
    • GRASP 65 antibody
    • GRASP65 antibody
    • MGC118894 antibody
    • MGC118897 antibody
    • P65 antibody
    see all

Images

  • Paraffin-embedded human colon cancer tissue stained for GRASP65 using ab238489 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human kidney tissue stained for GRASP65 using ab238489 at 1/100 dilution in immunohistochemical analysis.

References

ab238489 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab238489.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up