Overview

  • Product name

  • Description

    Rabbit polyclonal to GRHL2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Recombinant fragment corresponding to Human GRHL2 aa 112-261.
    Sequence:

    NRVQVLKTVPVNLSLNQDHLENSKREQYSISFPESSAIIPVSGITVVKAE DFTPVFMAPPVHYPRGDGEEQRVVIFEQTQYDVPSLATHSAYLKDDQRST PDSTYSESFKDAATEKFRSASVGAEEYMYDQTSSGTFQYTLEATKSLRQK


    Database link: Q6ISB3

  • Positive control

    • Human placenta tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab211360 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    May function as a transcription factor.
  • Tissue specificity

    Highly expressed in placenta, prostate, brain and kidney. Lower-level expression in a variety of epithelial tissues such as thymus, kidney, lung, salivary gland, mammary gland and digestive tract. Expressed in the cochlear.
  • Involvement in disease

    Defects in GRHL2 are the cause of deafness autosomal dominant type 28 (DFNA28) [MIM:608641]. DFNA28 is a form of sensorineural hearing loss. Sensorineural deafness results from damage to the neural receptors of the inner ear, the nerve pathways to the brain, or the area of the brain that receives sound information. DFNA28 is characterized by mild to moderate hearing loss across most frequencies that progressed to severe loss in the higher frequencies by the fifth decade. Age at onset varied, with the earliest case documented at 7 years of age.
  • Sequence similarities

    Belongs to the grh/CP2 family. Grainyhead subfamily.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • BOM antibody
    • Brother of mammalian grainyhead antibody
    • Deafness autosomal dominant 28 antibody
    • DFNA28 antibody
    • ECTDS antibody
    • FLJ11172 antibody
    • FLJ13782 antibody
    • Grainyhead like 2 (Drosophila) antibody
    • Grainyhead like 2 antibody
    • Grainyhead like protein 2 homolog antibody
    • Grainyhead like transcription factor 2 antibody
    • Grainyhead-like protein 2 homolog antibody
    • GRHL 2 antibody
    • GRHL2 antibody
    • GRHL2_HUMAN antibody
    • MGC149294 antibody
    • MGC149295 antibody
    • RGD1561191 antibody
    • TFCP2L3 antibody
    • Transcription factor CP2 like 3 antibody
    • Transcription factor CP2-like 3 antibody
    see all

Images

  • Immunohistochemical analysis of paraffin-embedded Human placenta tissue labeling GRHL2 with ab211360 at 1/200 dilution.

References

ab211360 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab211360.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up