Overview

  • Product name
    Anti-GRHL2 antibody [CL3760]
    See all GRHL2 primary antibodies
  • Description
    Mouse monoclonal [CL3760] to GRHL2
  • Host species
    Mouse
  • Tested applications
    Suitable for: IHC-Pmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human GRHL2 aa 112-261.
    Sequence:

    NRVQVLKTVPVNLSLNQDHLENSKREQYSISFPESSAIIPVSGITVVKAE DFTPVFMAPPVHYPRGDGEEQRVVIFEQTQYDVPSLATHSAYLKDDQRST PDSTYSESFKDAATEKFRSASVGAEEYMYDQTSSGTFQYTLEATKSLRQK


    Database link: Q6ISB3

  • Epitope
    Binds to an epitope located within the peptide sequence VVKAEDFTPV as determined by overlapping synthetic peptides.
  • Positive control
    • IHC-P: Human prostate, skin, fallopian tube, endometrium tube, rectum, kidney and liver tissues.

Properties

Applications

Our Abpromise guarantee covers the use of ab236758 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/5000 - 1/10000. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function
    May function as a transcription factor.
  • Tissue specificity
    Highly expressed in placenta, prostate, brain and kidney. Lower-level expression in a variety of epithelial tissues such as thymus, kidney, lung, salivary gland, mammary gland and digestive tract. Expressed in the cochlear.
  • Involvement in disease
    Defects in GRHL2 are the cause of deafness autosomal dominant type 28 (DFNA28) [MIM:608641]. DFNA28 is a form of sensorineural hearing loss. Sensorineural deafness results from damage to the neural receptors of the inner ear, the nerve pathways to the brain, or the area of the brain that receives sound information. DFNA28 is characterized by mild to moderate hearing loss across most frequencies that progressed to severe loss in the higher frequencies by the fifth decade. Age at onset varied, with the earliest case documented at 7 years of age.
  • Sequence similarities
    Belongs to the grh/CP2 family. Grainyhead subfamily.
  • Cellular localization
    Nucleus.
  • Information by UniProt
  • Database links
  • Alternative names
    • BOM antibody
    • Brother of mammalian grainyhead antibody
    • Deafness autosomal dominant 28 antibody
    • DFNA28 antibody
    • ECTDS antibody
    • FLJ11172 antibody
    • FLJ13782 antibody
    • Grainyhead like 2 (Drosophila) antibody
    • Grainyhead like 2 antibody
    • Grainyhead like protein 2 homolog antibody
    • Grainyhead like transcription factor 2 antibody
    • Grainyhead-like protein 2 homolog antibody
    • GRHL 2 antibody
    • GRHL2 antibody
    • GRHL2_HUMAN antibody
    • MGC149294 antibody
    • MGC149295 antibody
    • RGD1561191 antibody
    • TFCP2L3 antibody
    • Transcription factor CP2 like 3 antibody
    • Transcription factor CP2-like 3 antibody
    see all

Images

  • Paraffin-embedded human prostate tissue stained for GRHL2 using ab236758 at 1/5000 dilution in immunohistochemical analysis.

  • Paraffin-embedded human liver tissue stained for GRHL2 using ab236758 at 1/5000 dilution in immunohistochemical analysis.

  • Paraffin-embedded human kidney tissue stained for GRHL2 using ab236758 at 1/5000 dilution in immunohistochemical analysis.

  • Paraffin-embedded human rectum tissue stained for GRHL2 using ab236758 at 1/5000 dilution in immunohistochemical analysis.

  • Paraffin-embedded human endometrium tube tissue stained for GRHL2 using ab236758 at 1/5000 dilution in immunohistochemical analysis.

  • Paraffin-embedded human fallopian tube tissue stained for GRHL2 using ab236758 at 1/5000 dilution in immunohistochemical analysis.

  • Paraffin-embedded human skin tissue stained for GRHL2 using ab236758 at 1/5000 dilution in immunohistochemical analysis.

References

ab236758 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab236758.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up