Anti-GRHL3 antibody (ab221058)
Key features and details
- Rabbit polyclonal to GRHL3
- Suitable for: IHC-P, ICC/IF
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-GRHL3 antibody
See all GRHL3 primary antibodies -
Description
Rabbit polyclonal to GRHL3 -
Host species
Rabbit -
Tested applications
Suitable for: IHC-P, ICC/IFmore details -
Species reactivity
Reacts with: Human -
Immunogen
Recombinant fragment corresponding to Human GRHL3 aa 50-135.
Sequence:VNGDDDSVAALSFLYDYYMGPKEKRILSSSTGGRNDQGKRYYHGMEYETD LTPLESPTHLMKFLTENVSGTPEYPDLLKKNNLMSL
Database link: Q8TE85 -
Positive control
- IHC-P: Human urinary bladder, skin and oral mucosa tissue. ICC: MCF7 whole cells.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: 40% Glycerol (glycerin, glycerine), 59% PBS -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
Applications
Our Abpromise guarantee covers the use of ab221058 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
IHC-P | 1/1000 - 1/2500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. | |
ICC/IF | Use a concentration of 0.25 - 2 µg/ml. Fixation/Permeabilization: PFA/Triton X-100. |
Target
-
Function
May function as a transcription factor. -
Tissue specificity
Expressed in brain, colon, pancreas, placenta and kidney. Isoform 1 is expressed in lung and tonsil. Isoform 2 is prostate-specific. -
Sequence similarities
Belongs to the grh/CP2 family. Grainyhead subfamily. -
Cellular localization
Nucleus. - Information by UniProt
-
Database links
- Entrez Gene: 57822 Human
- Omim: 608317 Human
- SwissProt: Q8TE85 Human
- Unigene: 657920 Human
-
Alternative names
- Drosophila antibody
- Grainyhead like 3 antibody
- Grainyhead like protein 3 homolog antibody
see all
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-GRHL3 antibody (ab221058)
Immunohistochemical analysis of human urinary bladder tissue labeling GRHL3 in the nucleus of squamous epithelial cells with ab221058 at a 1/1000 dilution.
Performed heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
-
Immunocytochemical analysis of MCF7 (Human breast adenocarcinoma cell line) whole cells labeling GRHL3 (green) in the nucleoplasm with ab221058 at 2 µg/mL.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-GRHL3 antibody (ab221058)
Immunohistochemical analysis of human skin tissue labeling GRHL3 in the nucleus of squamous epithelial cells with ab221058 at a 1/1000 dilution.
Performed heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-GRHL3 antibody (ab221058)
Immunohistochemical analysis of human oral mucosa tissue labeling GRHL3 in the nucleus of squamous epithelial cells with ab221058 at a 1/1000 dilution.
Performed heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-GRHL3 antibody (ab221058)
Immunohistochemical analysis of human skeletal muscle tissue labeling GRHL3 with ab221058 at a 1/1000 dilution. No positivity as expected.
Performed heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
Protocols
Datasheets and documents
References (0)
ab221058 has not yet been referenced specifically in any publications.