Overview

  • Product name

  • Description

    Rabbit polyclonal to GRHPR
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
  • Immunogen

    Recombinant full length protein corresponding to Human GRHPR aa 1-328.
    Sequence:

    MRPVRLMKVFVTRRIPAEGRVALARAADCEVEQWDSDEPIPAKELERGVA GAHGLLCLLSDHVDKRILDAAGANLKVISTMSVGIDHLALDEIKKRGIRV GYTPDVLTDTTAELAVSLLLTTCRRLPEAIEEVKNGGWTSWKPLWLCGYG LTQSTVGIIGLGRIGQAIARRLKPFGVQRFLYTGRQPRPEEAAEFQAEFV STPELAAQSDFIVVACSLTPATEGLCNKDFFQKMKETAVFINISRGDVVN QDDLYQALASGKIAAAGLDVTSPEPLPTNHPLLTLKNCVILPHIGSATHR TRNTMSLLAANNLLAGLRGEPMPSELKL


    Database link: Q9UBQ7

  • Positive control

    • WB: Rat and mouse liver lysate. IHC-P: Human liver and testis tissue. ICC/IF: HepG2 cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab236665 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF 1/50 - 1/200.
IHC-P 1/20 - 1/200.
WB 1/500 - 1/5000. Predicted molecular weight: 36 kDa.

Target

  • Function

    Enzyme with hydroxy-pyruvate reductase, glyoxylate reductase and D-glycerate dehydrogenase enzymatic activities. Reduces hydroxypyruvate to D-glycerate, glyoxylate to glycolate oxidizes D-glycerate to hydroxypyruvate.
  • Tissue specificity

    Ubiquitous. Most abundantly expressed in the liver.
  • Involvement in disease

    Defects in GRHPR are the cause of hyperoxaluria primary type 2 (HP2) [MIM:260000]; also known as primary hyperoxaluria type II (PH2). HP2 is a disorder where the main clinical manifestation is calcium oxalate nephrolithiasis though chronic as well as terminal renal insufficiency has been described. It is characterized by an elevated urinary excretion of oxalate and L-glycerate.
  • Sequence similarities

    Belongs to the D-isomer specific 2-hydroxyacid dehydrogenase family.
  • Information by UniProt
  • Database links

  • Alternative names

    • GLXR antibody
    • glycerate 2 dehydrogenase antibody
    • GLYD antibody
    • Glyoxylate reductase/hydroxypyruvate reductase antibody
    • Grhpr antibody
    • GRHPR_HUMAN antibody
    • OTTHUMP00000021379 antibody
    • OTTHUMP00000021380 antibody
    • OTTHUMP00000046131 antibody
    • PH 2 antibody
    • PH2 antibody
    • Primary hyperoxaluria type 2 antibody
    see all

Images

  • All lanes : Anti-GRHPR antibody (ab236665) at 1/500 dilution

    Lane 1 : Rat liver lysate
    Lane 2 : Mouse liver lysate

    Secondary
    All lanes : Goat polyclonal to rabbit IgG at 1/50000 dilution

    Predicted band size: 36 kDa

  • Paraffin-embedded human liver tissue stained for GRHPR using ab236665 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human testis tissue stained for GRHPR using ab236665 at 1/100 dilution in immunohistochemical analysis.

  • HepG2 (human liver hepatocellular carcinoma cell line) cells labeling GRHPR using ab236665 at 1/100 dilution in ICC/IF. Secondary antibody was Alexa Fluor® 488-conjugated goat anti-rabbit IgG (H+L).

References

ab236665 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab236665.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up