Overview

  • Product name

    Anti-GRIK2/GluK2 antibody [8A1F11]
    See all GRIK2/GluK2 primary antibodies
  • Description

    Mouse monoclonal [8A1F11] to GRIK2/GluK2
  • Host species

    Mouse
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Cynomolgus monkey
  • Immunogen

    Recombinant fragment corresponding to Human GRIK2/GluK2 aa 45-226.
    Sequence:

    VESGPMGAEELAFRFAVNTINRNRTLLPNTTLTYDTQKINLYDSFEASKK ACDQLSLGVAAIFGPSHSSSANAVQSICNALGVPHIQTRWKHQVSDNKDS FYVSLYPDFSSLSRAILDLVQFFKWKTVTVVYDDSTGLIRLQELIKAPSR YNLRLKIRQLPADTKDAKPLLKEMKRGKEFHV


    Database link: Q13002

  • Positive control

    • WB: Recombinant human GRIK2/GluK2 (aa 45-226) protein; Human GRIK2/GluK2 (aa 45-226)-hIgGFc transfected HEK-293 cell lysate.
  • General notes

    Previously labelled as GRIK2. 

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    Preservative: 0.05% Sodium azide
    Constituent: PBS
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purified from tissue culture supernatant.
  • Clonality

    Monoclonal
  • Clone number

    8A1F11
  • Isotype

    IgG1
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab233719 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/2000.

Target

  • Function

    Ionotropic glutamate receptor. L-glutamate acts as an excitatory neurotransmitter at many synapses in the central nervous system. Binding of the excitatory neurotransmitter L-glutamate induces a conformation change, leading to the opening of the cation channel, and thereby converts the chemical signal to an electrical impulse. The receptor then desensitizes rapidly and enters a transient inactive state, characterized by the presence of bound agonist. May be involved in the transmission of light information from the retina to the hypothalamus. Modulates cell surface expression of NETO2.
  • Tissue specificity

    Expression is higher in cerebellum than in cerebral cortex.
  • Involvement in disease

    Defects in GRIK2 are the cause of mental retardation autosomal recessive type 6 (MRT6) [MIM:611092]. It is characterized by significantly sub-average general intellectual functioning associated with impairments in adaptative behavior and manifested during the developmental period. In contrast to syndromic or specific mental retardation which also present with associated physical, neurological and/or psychiatric manifestations, intellectual deficiency is the only primary symptom of non-syndromic mental retardation. MRT6 patients display mild to severe mental retardation and psychomotor development delay in early childhood. Patients do not have neurologic problems, congenital malformations, or facial dysmorphism. Body height, weight, and head circumference are normal.
  • Sequence similarities

    Belongs to the glutamate-gated ion channel (TC 1.A.10.1) family. GRIK2 subfamily.
  • Post-translational
    modifications

    Sumoylation mediates kainate receptor-mediated endocytosis and regulates synaptic transmission. Sumoylation is enhanced by PIAS3 and desumoylated by SENP1.
    Ubiquitinated. Ubiquitination regulates the GRIK2 levels at the synapse by leading kainate receptor degradation through proteasome.
  • Cellular localization

    Cell membrane. Cell junction > synapse > postsynaptic cell membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • bA487F5.1 antibody
    • EAA4 antibody
    • Excitatory amino acid receptor 4 antibody
    • GLR 6 antibody
    • GLR6 antibody
    • GluK2 antibody
    • GLUK6 antibody
    • GLUR 6 antibody
    • GluR-6 antibody
    • GluR6 antibody
    • Glutamate receptor 6 antibody
    • Glutamate receptor antibody
    • glutamate receptor form A antibody
    • glutamate receptor form B antibody
    • glutamate receptor form C antibody
    • glutamate receptor form D antibody
    • glutamate receptor form E antibody
    • Glutamate receptor ionotropic kainate 2 antibody
    • GRIK 2 antibody
    • GRIK2 antibody
    • GRIK2 protein antibody
    • GRIK2_HUMAN antibody
    • ionotropic kainate 2 antibody
    • MRT6 antibody
    see all

Images

  • Anti-GRIK2/GluK2 antibody [8A1F11] (ab233719) at 1/500 dilution + Recombinant human GRIK2/GluK2 (aa 45-226) protein

    Developed using the ECL technique.


    Expected MW is 47 kDa.

  • All lanes :

    Lane 1 : HEK-293 (human epithelial cell line from embryonic kidney) cell lysate
    Lane 2 : Human GRIK2/GluK2 (aa 45-226)-hIgGFc transfected HEK-293 cell lysate

    Developed using the ECL technique.

References

ab233719 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab233719.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up