Overview

  • Product name

    Anti-GRIK3/GluK3 antibody [2B3D1]
    See all GRIK3/GluK3 primary antibodies
  • Description

    Mouse monoclonal [2B3D1] to GRIK3/GluK3
  • Host species

    Mouse
  • Tested applications

    Suitable for: WB, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Cynomolgus monkey
  • Immunogen

    Recombinant fragment corresponding to Human GRIK3/GluK3 aa 32-173. Expressed in E.coli.
    Sequence:

    MPHVIRIGGIFEYADGPNAQVMNAEEHAFRFSANIINRNRTLLPNTTLTY DIQRIHFHDSFEATKKACDQLALGVVAIFGPSQGSCTNAVQSICNALEVP HIQLRWKHHPLDNKDTFYVNLYPDYASLSHAILDLVQYLKWR


    Database link: Q13003

  • Positive control

    • WB: Human GRIK3/GluK3 (aa 32-173) recombinant protein; GRIK3/GluK3 (aa 32-173)-hIgGFc transfected HEK-293 cell lysate. ICC/IF: HeLa cells.
  • General notes

     This product was previously labelled as GRIK3

     

Properties

Applications

Our Abpromise guarantee covers the use of ab233734 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/2000. Predicted molecular weight: 104 kDa.
ICC/IF 1/200 - 1/1000.

Target

  • Function

    Receptor for glutamate. L-glutamate acts as an excitatory neurotransmitter at many synapses in the central nervous system. The postsynaptic actions of Glu are mediated by a variety of receptors that are named according to their selective agonists. This receptor binds domoate > kainate >> L-glutamate = quisqualate >> AMPA = NMDA.
  • Sequence similarities

    Belongs to the glutamate-gated ion channel (TC 1.A.10.1) family. GRIK3 subfamily.
  • Cellular localization

    Cell membrane. Cell junction > synapse > postsynaptic cell membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • EAA5 antibody
    • Excitatory amino acid receptor 5 antibody
    • GLR 7 antibody
    • GLR7 antibody
    • GLU R7 antibody
    • GLUR 7 antibody
    • GluR 7a antibody
    • GluR-7 antibody
    • GluR7 antibody
    • GluR7a antibody
    • Glutamate receptor 7 antibody
    • Glutamate receptor antibody
    • Glutamate receptor ionotropic kainate 3 antibody
    • GRIK 3 antibody
    • GRIK3 antibody
    • GRIK3_HUMAN antibody
    • ionotropic kainate 3 antibody
    see all

Images

  • Anti-GRIK3/GluK3 antibody [2B3D1] (ab233734) at 1/500 dilution + Human GRIK3/GluK3 (aa 32-173) recombinant protein.

    Predicted band size: 104 kDa



    Expected MW is 42 kDa.

  • All lanes : Anti-GRIK3/GluK3 antibody [2B3D1] (ab233734) at 1/500 dilution

    Lane 1 : HEK-293 (human epithelial cell line from embryonic kidney) cell lysate.
    Lane 2 : GRIK3/GluK3 (aa 32-173)-hIgGFc transfected HEK293 cell lysate.

    Predicted band size: 104 kDa

  • Immunofluorescence analysis of Hela (human epithelial cell line from cervix adenocarcinoma) cells labelling GRIK3/GluK3 using ab233734 at 1/200 dilution. Blue: DRAQ5 fluorescent DNA dye. Red: Actin filaments labeled with AlexaFluor®-555-Phalloidin.

References

ab233734 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab233734.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up