Anti-GRIN1 antibody (ab203632)
- Datasheet
- References
- Protocols
Overview
-
Product name
Anti-GRIN1 antibody
See all GRIN1 primary antibodies -
Description
Rabbit polyclonal to GRIN1 -
Host species
Rabbit -
Tested applications
Suitable for: IHC-P, WBmore details -
Species reactivity
Reacts with: Human -
Immunogen
Synthetic peptide within Human GRIN1 aa 132-178 conjugated to keyhole limpet haemocyanin. The exact sequence is proprietary.
Sequence:VSSVKTEPKSSDDRNPMFLEKMDFKSSKQADSTSIGKEDPGSSRKAD
Database link: Q7Z2K8 -
Positive control
- IHC-P: Rat brain tissue.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
Preservative: 0.09% Sodium azide
Constituents: 50% Glycerol, 0.01% BSA -
Concentration information loading... -
Purity
Protein A purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
Applications
Our Abpromise guarantee covers the use of ab203632 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| IHC-P | 1/100 - 1/500. When using a fluorescent probe the recommended dilution is 1/50 - 1/200. |
|
| WB | 1/100 - 1/1000. Predicted molecular weight: 102 kDa. |
Target
-
Function
May be involved in neurite outgrowth. -
Tissue specificity
Widely expressed in the central nervous system, with highest levels in spinal cord. -
Post-translational
modificationsPalmitoylation on Cys-999 and/or Cys-1000 is required for membrane targeting. -
Cellular localization
Cell membrane. Cell projection, growth cone. Highly enriched in growth cone. - Information by UniProt
-
Database links
- Entrez Gene: 114787 Human
- Omim: 611239 Human
- SwissProt: Q7Z2K8 Human
- Unigene: 150549 Human
-
Alternative names
- G protein regulated inducer of neurite outgrowth 1 antibody
- G protein-regulated inducer of neurite outgrowth 1 antibody
- GPRIN1 antibody
see all
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-GRIN1 antibody (ab203632)Immunohistochemical analysis of formalin-fixed and paraffin embedded Rat brain labeling GRIN1 with ab203632 at 1/200 followed by conjugation to the secondary antibody and DAB staining
Datasheets and documents
References
ab203632 has not yet been referenced specifically in any publications.
