Anti-GRIN1 antibody (ab203632)
Key features and details
- Rabbit polyclonal to GRIN1
- Suitable for: IHC-P
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-GRIN1 antibody
See all GRIN1 primary antibodies -
Description
Rabbit polyclonal to GRIN1 -
Host species
Rabbit -
Tested applications
Suitable for: IHC-Pmore details -
Species reactivity
Reacts with: Human -
Immunogen
Synthetic peptide within Human GRIN1 aa 132-178 conjugated to keyhole limpet haemocyanin. The exact sequence is proprietary.
Sequence:VSSVKTEPKSSDDRNPMFLEKMDFKSSKQADSTSIGKEDPGSSRKAD
Database link: Q7Z2K8 -
Positive control
- IHC-P: Rat brain tissue.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
Preservative: 0.09% Sodium azide
Constituents: 50% Glycerol, 0.01% BSA -
Concentration information loading...
-
Purity
Protein A purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
Applications
Our Abpromise guarantee covers the use of ab203632 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
IHC-P | 1/100 - 1/500. When using a fluorescent probe the recommended dilution is 1/50 - 1/200. |
Target
-
Function
May be involved in neurite outgrowth. -
Tissue specificity
Widely expressed in the central nervous system, with highest levels in spinal cord. -
Post-translational
modificationsPalmitoylation on Cys-999 and/or Cys-1000 is required for membrane targeting. -
Cellular localization
Cell membrane. Cell projection, growth cone. Highly enriched in growth cone. - Information by UniProt
-
Database links
- Entrez Gene: 114787 Human
- Omim: 611239 Human
- SwissProt: Q7Z2K8 Human
- Unigene: 150549 Human
-
Alternative names
- G protein regulated inducer of neurite outgrowth 1 antibody
- G protein-regulated inducer of neurite outgrowth 1 antibody
- GPRIN1 antibody
see all
Images
Datasheets and documents
References (0)
ab203632 has not yet been referenced specifically in any publications.