Overview

  • Product name

  • Description

    Rabbit polyclonal to GRIP1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Rat, Human
  • Immunogen

    Recombinant full length protein corresponding to Human GRIP1 aa 1-336.
    Sequence:

    MSQPSGGRAPGTRIYSWSCPTVMSPGEKLDPIPDSFILQPPVFHPVVPYV TTIFGGLHAGKMVMLQGVVPLDAHRFQVDFQCGCSLCPRPDIAFHFNPRF HTTKPHVICNTLHGGRWQREARWPHLALRRGSSFLILFLFGNEEVKVSVN GQHFLHFRYRLPLSHVDTLGIFGDILVEAVGFLNINPFVEGSREYPAGHP FLLMSPRLEVPCSHALPQGLSPGQVIIVRGLVLQEPKHFTVSLRDQAAHA PVTLRASFADRTLAWISRWGQKKLISAPFLFYPQRFFEVLLLFQEGGLKL ALNGQGLGATSMNQQALEQLRELRISGSVQLYCVHS


    Database link: Q96DT0

  • Positive control

    • WB: A549 whole cell lysate; Rat kidney lysate. IHC-P: Human skin and breast cancer tissues.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.03% Proclin
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purity >95%.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab235039 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/5000. Predicted molecular weight: 38 kDa.
IHC-P 1/50 - 1/500.

Target

  • Function

    Binds lactose. May participate in the apoptosis of adipocytes.
  • Tissue specificity

    Not widely expressed. Predominantly expressed in adipose tissue.
  • Sequence similarities

    Contains 2 galectin domains.
  • Domain

    Contains two homologous but distinct carbohydrate-binding domains.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • Gal-12 antibody
    • Galectin related inhibitor of proliferation antibody
    • Galectin-12 antibody
    • Galectin-related inhibitor of proliferation antibody
    • GRIP1 antibody
    • Lectin galactoside binding soluble 12 (galectin 12) antibody
    • LEG12_HUMAN antibody
    • Lgals12 antibody
    see all

Images

  • All lanes : Anti-GRIP1 antibody (ab235039) at 1/500 dilution

    Lane 1 : A549 (human lung carcinoma cell line) whole cell lysate
    Lane 2 : Rat kidney lysate

    Secondary
    All lanes : Goat polyclonal to rabbit IgG at 1/50000 dilution

    Predicted band size: 38 kDa

  • Paraffin-embedded human skin tissue stained for GRIP1 using ab235039 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human breast cancer tissue stained for GRIP1 using ab235039 at 1/100 dilution in immunohistochemical analysis.

References

ab235039 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab235039.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up