Overview

  • Product name

  • Description

    Rabbit polyclonal to GRK4
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment within Human GRK4 aa 36-145. The exact sequence is proprietary. (With tag; BC117320).
    Sequence:

    LPPVSQCSELRHSIEKDYSSLCDKQPIGRRLFRQFCDTKPTLKRHIEFLD AVAEYEVADDEDRSDCGLSILDRFFNDKLAAPLPEIPPDVVTECRLGLKE ENPSKKAFEE


    Database link: P32298

  • Positive control

    • HeLa and Jurkat cell lysates; Human liver cancer tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.30
    Preservative: 0.05% Sodium azide
    Constituents: 50% Glycerol, 49% PBS

    Note: PBS without Mg2+ and Ca2+.
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab182635 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/1000 - 1/5000. Predicted molecular weight: 67 kDa.
IHC-P 1/50 - 1/200.

Target

  • Function

    Specifically phosphorylates the activated forms of G protein-coupled receptors. GRK4-alpha can phosphorylate rhodopsin and its activity is inhibited by calmodulin; the other three isoforms do not phosphorylate rhodopsin and do not interact with calmodulin. GRK4-alpha and GRK4-gamma phosphorylate DRD3. Phosphorylates ADRB2.
  • Tissue specificity

    Isoform 1, isoform 2, isoform 3, and isoform 4 are expressed in testis. Isoform 4 is expressed in myometrium.
  • Sequence similarities

    Belongs to the protein kinase superfamily. AGC Ser/Thr protein kinase family. GPRK subfamily.
    Contains 1 AGC-kinase C-terminal domain.
    Contains 1 protein kinase domain.
    Contains 1 RGS domain.
  • Post-translational
    modifications

    Palmitoylated.
  • Cellular localization

    Cytoplasm. Cytoplasm > cell cortex. Both at the cell surface and dispersed in the cytoplasm under basal conditions. Receptor stimulation results in the internalization of GRK4 to the perinuclear area, where co-localization with DRD3 is observed strongly at 5 and 15 minutes. DRD3 and GRK4 co-localize in lipid rafts of renal proximal tubule cells.
  • Information by UniProt
  • Database links

  • Alternative names

    • G protein coupled receptor kinase 4 antibody
    • G protein-coupled receptor kinase 2 (Drosophila)-like antibody
    • G protein-coupled receptor kinase 4 antibody
    • G protein-coupled receptor kinase GRK4 antibody
    • G proteinm coupled receptor kinase GRK4 antibody
    • GPRK2L antibody
    • GPRK4 antibody
    • GRK4 antibody
    • GRK4_HUMAN antibody
    • GRK4a antibody
    • ITI1 antibody
    see all

Images

  • All lanes : Anti-GRK4 antibody (ab182635) at 1/700 dilution

    Lane 1 : HeLa cell lysate
    Lane 2 : Jurkat cell lysate

    Lysates/proteins at 40 µg per lane.

    Secondary
    All lanes : Goat anti Rabbit IgG - H&L (HRP) at 1/10000 dilution

    Predicted band size: 67 kDa


    Exposure time: 40 seconds


    Gel: 10% SDS-PAGE

  • Immunohistochemical analysis of paraffin-embedded Human liver cancer tissue labeling GRK4 with ab182635 at 1/40 dilution (left panel). Right panel treated with the immunogen.

References

ab182635 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab182635.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up