Overview

  • Product name

    Anti-GRO alpha antibody (Biotin)
    See all GRO alpha primary antibodies
  • Description

    Rabbit polyclonal to GRO alpha (Biotin)
  • Host species

    Rabbit
  • Conjugation

    Biotin
  • Tested applications

    Suitable for: WB, Sandwich ELISAmore details
  • Species reactivity


    Predicted to work with: Rat
  • Immunogen

    Recombinant full length protein corresponding to Rat GRO alpha aa 25-96. Full-length mature chain lacking the signal peptide. Produced in E.coli.
    Sequence:

    APVANELRCQCLQTVAGIHFKNIQSLKVMPPGPHCTQTEVIATLKNGREA CLDPEAPMVQKIVQKMLKGVPK


    Database link: P14095

  • Positive control

    • WB: Recombinant rat GRO alpha protein. sELISA: Recombinant rat GRO alpha protein.

Properties

  • Form

    Lyophilised:Reconstitute in sterile PBS with 0.1% BSA to 0.1 - 1.0 mg/ml.
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. Store In the Dark.
  • Storage buffer

    pH: 7.20
    Constituent: PBS
  • Concentration information loading...
  • Purity

    Affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab245860 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.1 - 0.2 µg/ml. Predicted molecular weight: 11 kDa.
Sandwich ELISA Use a concentration of 0.25 - 1 µg/ml.

Target

  • Function

    Has chemotactic activity for neutrophils. May play a role in inflammation and exerts its effects on endothelial cells in an autocrine fashion. In vitro, the processed forms GRO-alpha(4-73), GRO-alpha(5-73) and GRO-alpha(6-73) show a 30-fold higher chemotactic activity.
  • Sequence similarities

    Belongs to the intercrine alpha (chemokine CxC) family.
  • Post-translational
    modifications

    N-terminal processed forms GRO-alpha(4-73), GRO-alpha(5-73) and GRO-alpha(6-73) are produced by proteolytic cleavage after secretion from peripheral blood monocytes.
  • Cellular localization

    Secreted.
  • Information by UniProt
  • Database links

  • Alternative names

    • C-X-C motif chemokine 1 antibody
    • Chemokine (C-X-C motif) ligand 1 (melanoma growth stimulating activity, alpha) antibody
    • chemokine (C-X-C motif) ligand 1 antibody
    • CINC-1 antibody
    • CXCL1 antibody
    • Cytokine-induced neutrophil chemoattractant 1 antibody
    • Fibroblast secretory protein antibody
    • Fsp antibody
    • Gro 1 antibody
    • Gro A antibody
    • Gro antibody
    • GRO protein, alpha antibody
    • GRO-alpha(1-73) antibody
    • GRO-alpha(6-73) antibody
    • Gro1 antibody
    • GRO1 oncogene (melanoma growth stimulating activity, alpha) antibody
    • GRO1 oncogene (melanoma growth-stimulating activity) antibody
    • Gro1 oncogene antibody
    • GROa antibody
    • GROA_HUMAN antibody
    • Growth-regulated alpha protein antibody
    • KC antibody
    • KC chemokine, mouse, homolog of antibody
    • melanoma growth stimulatory activity alpha antibody
    • Melanoma growth stimulatory activity antibody
    • Melanoma growth stimulatory activity, alpha antibody
    • MGSA alpha antibody
    • MGSA antibody
    • MGSA-a antibody
    • N51 antibody
    • NAP-3 antibody
    • NAP3 antibody
    • Neutrophil-activating protein 3 antibody
    • Platelet-derived growth factor-inducible protein KC antibody
    • Scyb 1 antibody
    • Scyb1 antibody
    • Secretory protein N51 antibody
    • Small inducible cytokine subfamily B, member 1 antibody
    see all

Images

  • To detect rat GRO alpha by Western Blot analysis ab245860 can be used at a concentration of 0.1 - 0.2 µg/ml.

    When used in conjunction with compatible secondary reagents, the detection limit for recombinant rat GRO alpha is 1.5 - 3.0 ng/lane, under either reducing or non-reducing conditions.

    Lane 1: Marker

    Lanes 2-12: 250, 125, 62.5, 31.25, 15.625, 7.8, 3.9, 1.95, 0.975, 0.4875 and 0.24 ng recombinant rat GRO alpha,  respectively.

     

  • To detect rat GRO alpha by sandwich ELISA (using 100 μl/well antibody solution) a concentration of 0.25 – 1.0 μg/ml of ab245860 is required.

    This biotinylated polyclonal antibody, in conjunction with a capture antibody, allows the detection of at least 0.2 – 0.4 ng/well of recombinant rat GRO alpha.

References

ab245860 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab245860.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up