Overview

  • Product name
  • Description
    Rabbit polyclonal to GRO gamma
  • Host species
    Rabbit
  • Tested applications
    Suitable for: WB, IHC-Pmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Pig
  • Immunogen

    Synthetic peptide corresponding to Human GRO gamma aa 58-107 conjugated to keyhole limpet haemocyanin.
    Sequence:

    QSVNVRSPGPHCAQTEVIATLKNGKKACLNPASPMVQKIIEKILNKGSTN

  • Positive control
    • HeLa whole cell lysate.
  • General notes


    CXCL3 may play a role in inflammation and exert its effects on endothelial cells in an autocrine fashion.

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
  • Storage buffer
    Preservative: 0.09% Sodium azide
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • Purity
    Protein A purified
  • Primary antibody notes
    CXCL3 may play a role in inflammation and exert its effects on endothelial cells in an autocrine fashion.
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab10064 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/1000. Detects a band of approximately 11 kDa (predicted molecular weight: 12.7 kDa). Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.
IHC-P Use at an assay dependent concentration.

Target

  • Function
    Ligand for CXCR2 (By similarity). Has chemotactic activity for neutrophils. May play a role in inflammation and exert its effects on endothelial cells in an autocrine fashion. In vitro, the processed form GRO-gamma(5-73) shows a fivefold higher chemotactic activity for neutrophilic granulocytes.
  • Sequence similarities
    Belongs to the intercrine alpha (chemokine CxC) family.
  • Post-translational
    modifications
    N-terminal processed form GRO-gamma(5-73) is produced by proteolytic cleavage after secretion from peripheral blood monocytes.
  • Cellular localization
    Secreted.
  • Information by UniProt
  • Database links
  • Alternative names
    • C-X-C motif chemokine 3 antibody
    • C-X-C motif chemokine ligand 3 antibody
    • Chemokine (C X C motif) ligand 3 antibody
    • Chemokine (CXC motif) ligand 3 antibody
    • Cinc 2 antibody
    • CINC 2b antibody
    • Cinc2 antibody
    • CINC2b antibody
    • CXCL 3 antibody
    • Cxcl3 antibody
    • CXCL3_HUMAN antibody
    • Cytokine induced neutrophil chemoattractant 2 antibody
    • Dcip1 antibody
    • Dendritic cell inflammatory protein 1 antibody
    • Gm1960 antibody
    • GRO protein gamma antibody
    • GRO-gamma antibody
    • GRO-gamma(1-73) antibody
    • GRO-gamma(5-73) antibody
    • GRO3 antibody
    • GRO3 oncogene antibody
    • GROG antibody
    • Growth regulated protein gamma antibody
    • Growth-regulated protein gamma antibody
    • Macrophage inflammatory protein 2 beta precursor antibody
    • Macrophage inflammatory protein 2-beta antibody
    • Melanoma growth stimulatory activity gamma antibody
    • Member 3 antibody
    • MGSA gamma antibody
    • MIP 2b antibody
    • MIP2-beta antibody
    • MIP2B antibody
    • SCYB3 antibody
    • Small inducible cytokine subfamily B antibody
    see all

Images

  • ab10064 at 1/1000 dilution staining approximately 11kDa band of human CXCL3 in HeLa whole cell lysate by Western blot (ECL). ab10064 at 1/1000 dilution staining approximately 11kDa band of human CXCL3 in HeLa whole cell lysate by Western blot (ECL).

References

This product has been referenced in:
  • Han KQ  et al. Inflammatory microenvironment and expression of chemokines in hepatocellular carcinoma. World J Gastroenterol 21:4864-74 (2015). IHC-P ; Mouse . Read more (PubMed: 25944999) »
See 1 Publication for this product

Customer reviews and Q&As

1-2 of 2 Abreviews or Q&A

Abcam guarantees this product to work in the species/application used in this Abreview.
Application
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Sample
Human Tissue sections (Human Tissue sections (Intervertebral Discs))
Specification
Human Tissue sections (Intervertebral Discs)
Fixative
Paraformaldehyde
Antigen retrieval step
Heat mediated - Buffer/Enzyme Used: Tris Buffer pH:9,5 for 2x5’ in MW 40% power
Permeabilization
No
Blocking step
Serum as blocking agent for 1 hour(s) and 30 minute(s) · Concentration: 1% · Temperature: 22°C

Abcam user community

Verified customer

Submitted Apr 11 2012

Question
Answer

Thank you for contacting us today.

I am very pleased to hear you would like to test ab86436, ab9841and ab10064with IHC ofparaffin embedded human tissue sections. The codes below will each give you 1 freeprimary antibodybefore the expiration date. To redeem this offer, please submit an Abreview forIHC-P and include this code in the “Additional Comments” section so we know the Abreview is for this promotion. For more information on how to submit an Abreview, please visit the site:

https://www.abcam.com/Abreviews


ab86436
DISCOUNT CODE: xxxxx

Expiration date: 2012-06-04


ab9841
DISCOUNT CODE: xxxxx

Expiration date: 2012-06-04

ab10064

DISCOUNT CODE: xxxxxx

Expiration date: 2012-06-04

As discussed over the phone, we publish both positive and negative Abreviews on our datasheets so please submit the results of your tests whatever they may be. The code will be active once the Abreview has been submitted and can be redeemed in one of the following ways:

1) Call to place your order and mention the code to our customer service department;
2) Include the code in your fax order;
3) Place your order on the web and enter the promotional code.

Any feedback that you can provide will be greatly appreciated, whether positive or negative. If you have any further questions, please do not hesitate to contact us. We look forward to receiving your Abreview and wish you luck with your research.

The terms and conditions applicable to this offer can be found here:

https://www.abcam.com/collaborationdiscount

Read More

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up