Overview

  • Product name

    Anti-Growth Hormone antibody
    See all Growth Hormone primary antibodies
  • Description

    Rabbit polyclonal to Growth Hormone
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Rat
    Predicted to work with: Mouse, Rabbit, Horse, Guinea pig, Cow, Cat, Dog, Pig
  • Immunogen

    Recombinant full length protein (His-T7-tag) corresponding to Dog Growth Hormone aa 27-216. Full length mature chain, expressed in E.coli.
    Sequence:

    FPAMPLSSLFANAVLRAQHLHQLAADTYKEFERAYIPEGQRYSIQNAQAA FCFSETIPAPTGKDEAQQRSDVELLRFSLLLIQSWLGPVQFLSRVFTNSL VFGTSDRVYEKLKDLEEGIQALMRELEDGSPRAGQILKQTYDKFDTNLRS DDALLKNYGLLSCFKKDLHKAETYLRVMKCRRFVESSCAF


    Database link: P33711

  • Positive control

    • WB: Rat cerebellum lysate; Recombinant dog Growth Hormone protein.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    ab230996 was purified by antigen-specific affinity chromatography followed by Protein A affinity chromatography.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab230996 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 24 kDa.

Target

  • Function

    Plays an important role in growth control. Its major role in stimulating body growth is to stimulate the liver and other tissues to secrete IGF-1. It stimulates both the differentiation and proliferation of myoblasts. It also stimulates amino acid uptake and protein synthesis in muscle and other tissues.
  • Involvement in disease

    Defects in GH1 are a cause of growth hormone deficiency isolated type 1A (IGHD1A) [MIM:262400]; also known as pituitary dwarfism I. IGHD1A is an autosomal recessive deficiency of GH which causes short stature. IGHD1A patients have an absence of GH with severe dwarfism and often develop anti-GH antibodies when given exogenous GH.
    Defects in GH1 are a cause of growth hormone deficiency isolated type 1B (IGHD1B) [MIM:612781]; also known as dwarfism of Sindh. IGHD1B is an autosomal recessive deficiency of GH which causes short stature. IGHD1B patients have low but detectable levels of GH. Dwarfism is less severe than in IGHD1A and patients usually respond well to exogenous GH.
    Defects in GH1 are the cause of Kowarski syndrome (KWKS) [MIM:262650]; also known as pituitary dwarfism VI.
    Defects in GH1 are a cause of growth hormone deficiency isolated type 2 (IGHD2) [MIM:173100]. IGHD2 is an autosomal dominant deficiency of GH which causes short stature. Clinical severity is variable. Patients have a positive response and immunologic tolerance to growth hormone therapy.
  • Sequence similarities

    Belongs to the somatotropin/prolactin family.
  • Cellular localization

    Secreted.
  • Information by UniProt
  • Database links

  • Alternative names

    • gH antibody
    • GH-N antibody
    • GH1 antibody
    • GHB5 antibody
    • GHN antibody
    • Growth hormone 1 antibody
    • Growth hormone antibody
    • Growth hormone B5 antibody
    • Growth hormone, normal antibody
    • Growth hormone, pituitary antibody
    • HG1 antibody
    • hGH-N antibody
    • IGHD1B antibody
    • Pituitary growth hormone antibody
    • RNGHGP antibody
    • SOMA_HUMAN antibody
    • Somatotropin antibody
    see all

Images

  • Anti-Growth Hormone antibody (ab230996) at 2 µg/ml + Rat cerebellum lysate

    Predicted band size: 24 kDa

  • Anti-Growth Hormone antibody (ab230996) at 2 µg/ml + Recombinant dog Growth Hormone protein

    Predicted band size: 24 kDa

References

ab230996 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab230996.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up