Overview

  • Product name

    Anti-GRP94 antibody [CL2647] - C-terminal
    See all GRP94 primary antibodies
  • Description

    Mouse monoclonal [CL2647] to GRP94 - C-terminal
  • Host species

    Mouse
  • Tested applications

    Suitable for: WB, ICC/IF, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Cow, Dog, Pig, Cynomolgus monkey, Orangutan
  • Immunogen

    Recombinant fragment (proprietary-tag) corresponding to Human GRP94 aa 655-798 (C terminal).
    Sequence:

    SGNMERIMKAQAYQTGKDISTNYYASQKKTFEINPRHPLIRDMLRRIKED EDDKTVLDLAVVLFETATLRSGYLLPDTKAYGDRIERMLRLSLNIDPDAK VEEEPEEEPEETAEDTTEDTEQDEDEEMDVGTDEEEETAKESTA


    Database link: P14625

  • Epitope

    Binds to an epitope located within the peptide sequence EEEPEETAED as determined by overlapping synthetic peptides.
  • Positive control

    • U251 lysate; U251, HeLa, A431, MCF7 and U2OS cells; Hepatocytes; Human liver, Human prostate, Human cortex and Human rectum tissues.

Properties

Applications

Our Abpromise guarantee covers the use of ab210960 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/1000. Predicted molecular weight: 92 kDa.
ICC/IF Use a concentration of 1 - 4 µg/ml.
IHC-P 1/5000 - 1/10000. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    Molecular chaperone that functions in the processing and transport of secreted proteins. Functions in endoplasmic reticulum associated degradation (ERAD). Has ATPase activity.
  • Sequence similarities

    Belongs to the heat shock protein 90 family.
  • Cellular localization

    Endoplasmic reticulum lumen. Melanosome. Identified by mass spectrometry in melanosome fractions from stage I to stage IV.
  • Information by UniProt
  • Database links

  • Alternative names

    • 94 kDa glucose regulated protein antibody
    • 94 kDa glucose-regulated protein antibody
    • ECGP antibody
    • Endoplasmin antibody
    • Endothelial cell (HBMEC) glycoprotein antibody
    • ENPL_HUMAN antibody
    • Glucose regulated protein 94kDa antibody
    • gp96 antibody
    • gp96 homolog antibody
    • GRP 94 antibody
    • GRP-94 antibody
    • Heat shock protein 90 kDa beta member 1 antibody
    • heat shock protein 90kDa beta (Grp94), member 1 antibody
    • Heat shock protein, 90 kDa, beta, 1 antibody
    • HSP90B1 antibody
    • Stress inducible tumor rejection antigen GP96 antibody
    • TRA1 antibody
    • tumor rejection antigen (gp96) 1 antibody
    • Tumor rejection antigen 1 antibody
    • Tumor rejection antigen gp96 antibody
    • Tumor rejection antigen-1 (gp96) antibody
    see all

Images

  • All lanes : Anti-GRP94 antibody [CL2647] - C-terminal (ab210960)

    Lane 1 : U-251 cells, transfected with control siRNA
    Lane 2 : U-251 cells, transfected with target specific siRNA probe #1
    Lane 3 : U-251 cells, transfected with target specific siRNA probe #2

    Predicted band size: 92 kDa



    Downregulation of antibody signal confirms target specificity. Remaining % intensity, relative control lane, is indicated. Anti-PPIB monoclonal antibody was used as loading control.

  • Immunofluorescence analysis of U251 cells labeling GRP94 (green) with ab210960 at 4 μg/ml. Nuclei were counterstained with DAPI (blue).

  • Anti-GRP94 antibody [CL2647] - C-terminal (ab210960) at 1/500 dilution + U251 lysate

    Predicted band size: 92 kDa

  • Immunofluorescence analysis of U2OS cells labeling GRP94 (green) with ab210960 at 4 μg/ml. Nuclei were counterstained with DAPI (blue).

  • Immunofluorescence analysis of MCF7 cells labeling GRP94 (green) with ab210960 at 4 μg/ml. Nuclei were counterstained with DAPI (blue).

  • Immunofluorescence analysis of A431 cells labeling GRP94 (green) with ab210960 at 4 μg/ml. Nuclei were counterstained with DAPI (blue).

  • Immunofluorescence analysis of HeLa cells labeling GRP94 (green) with ab210960 at 4 μg/ml. Nuclei were counterstained with DAPI (blue).

  • Immunohistochemical analysis of formalin-fixed paraffin-embedded Human liver tissue labeling GRP94 with ab210960 at 1/5000 dilution.

  • Immunohistochemical analysis of formalin-fixed paraffin-embedded Human rectum tissue labeling GRP94 with ab210960 at 1/5000 dilution.

  • Immunohistochemical analysis of formalin-fixed paraffin-embedded Human cortex tissue labeling GRP94 with ab210960 at 1/5000 dilution.

  • Immunohistochemical analysis of formalin-fixed paraffin-embedded Human prostate tissue labeling GRP94 with ab210960 at 1/5000 dilution.

References

ab210960 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Application
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Sample
Rhesus monkey Tissue sections (Oropharyngeal mucosa)
Antigen retrieval step
Heat mediated - Buffer/Enzyme Used: High pH buffer followed by low pH citrate buffer
Permeabilization
Yes - Triton-X-100
Specification
Oropharyngeal mucosa
Blocking step
10% Normal Goat Serum + 2% BSA as blocking agent for 45 minute(s) · Concentration: 10% · Temperature: 25°C
Fixative
Z-FIX

Abcam user community

Verified customer

Submitted Jun 24 2019

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up