Overview

  • Product name

    Anti-GRP94 antibody [SPM249] - BSA free
    See all GRP94 primary antibodies
  • Description

    Rat monoclonal [SPM249] to GRP94 - BSA free
  • Host species

    Rat
  • Tested applications

    Suitable for: ICC/IF, Flow Cyt, WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Sheep, Rabbit, Horse, Chicken, Guinea pig, Hamster, Cow, Dog, Human, Pig, Xenopus laevis, Monkey
    Predicted to work with: Orangutan
  • Immunogen

    Full length native protein (purified) corresponding to Chicken GRP94 aa 22-795. (Purified from chicken oviducts).
    Sequence:

    EEVDVDATVEEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIKEIREK SEKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTD ENALAGNEELTVKIKCDKEKNMLHVTDTGIGMTKEELIKNLGTIAKSGTS EFLNKMTEMQDDSQSTSELIGQFGVGFYSAFLVADRVIVTSKHNNDTQHI WESDSNEFSVIDDPRGNTLGRGTTITLVLKEEASDYLELDTVKNLVKKYS QFINFPIYVWSSKTETVEEPVEEEEAKEEKEETDDNEAAVEEEEEEKKPK TKKVEKTVWDWELMNDIKPIWQRPSKEVEEDEYKAFYKTFSKEHDDPMAY IHFTAEGEVTFKSILFVPNSAPRGLFDEYGSKKSDFIKLYVRRVFITDDF HDMMPKYLNFVKGVVDSDDLPLNVSRETLQQHKLLKVIRKKLVRKTLDMI KKIAEEKYNDTFWKEFGTNVKLGVIEDHSNRTRLAKLLRFQSSHHESNLT SLDQYVERMKEKQDKIYFMAGASRKEAESSPFVERLLKKGYEVIYLTEPV DEYCIQALPEFDGKRFQNVAKEGVKFEESEKSKESREALEKEFEPLLNWM KDKALKDKIEKAVLSQRLTQSPCALVASQYGWSGNMERIMKAQAYQTGKD ISTNYYASQKKTFEINPRHPLIKDMLRRVKENEDDKTVSDLAVVLFETAT LRSGYMLPDTKEYGDRIERMLRLSLNIDLDAKVEEEPEEPEDAAEEAEQD EEEVDADAEDSETQKESTDVKDEL


    Database link: P08110

  • Positive control

    • Human breast carcinoma issue; U20S cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab212912 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 0.5 - 1 µg/ml.
Flow Cyt Use 0.5-1µg for 106 cells.

(in 0.1 ml).

WB Use a concentration of 0.5 - 1 µg/ml. Predicted molecular weight: 92 kDa.
IHC-P Use a concentration of 0.5 - 1 µg/ml. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

(Primary incubation for 30 minutes at RT).

Target

Images

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded Human breast carcinoma tissue labeling GRP94 with ab212912 at 1 µg/ml.

References

ab212912 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab212912.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up