Overview

  • Product name

  • Description

    Rabbit polyclonal to GRPEL2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Cow, Orangutan
  • Immunogen

    Recombinant full length protein corresponding to Human GRPEL2 aa 33-225.
    Sequence:

    STATQRTAGEDCRSEDPPDELGPPLAERALRVKAVKLEKEVQDLTVRYQR AIADCENIRRRTQRCVEDAKIFGIQSFCKDLVEVADILEKTTECISEESE PEDQKLTLEKVFRGLLLLEAKLKSVFAKHGLEKLTPIGDKYDPHEHELIC HVPAGVGVQPGTVALVRQDGYKLHGRTIRLARVEVAVESQRRL


    Database link: Q8TAA5

  • Positive control

    • IHC-P: Human colon cancer and adrenal gland tissues.

Properties

Applications

Our Abpromise guarantee covers the use of ab229985 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.

Target

  • Function

    Essential component of the PAM complex, a complex required for the translocation of transit peptide-containing proteins from the inner membrane into the mitochondrial matrix in an ATP-dependent manner. Seems to control the nucleotide-dependent binding of mitochondrial HSP70 to substrate proteins. Stimulates ATPase activity of mt-HSP70. May also serve to modulate the interconversion of oligomeric (inactive) and monomeric (active) forms of mt-HSP70.
  • Sequence similarities

    Belongs to the grpE family.
  • Cellular localization

    Mitochondrion matrix.
  • Information by UniProt
  • Database links

  • Alternative names

    • GrpE like 2, mitochondrial antibody
    • GrpE protein homolog 2 antibody
    • GRPE2_HUMAN antibody
    • GRPEL 2 antibody
    • Grpel2 antibody
    • mitochondrial antibody
    • Mt GrpE#2 antibody
    • Mt-GrpE#2 antibody
    see all

Images

  • Paraffin-embedded human colon cancer tissue stained for GRPEL2 using ab229985 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human adrenal gland tissue stained for GRPEL2 using ab229985 at 1/100 dilution in immunohistochemical analysis.

References

ab229985 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab229985.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up