Overview

  • Product name

    Anti-GS15 antibody
  • Description

    Rabbit polyclonal to GS15
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human GS15 aa 1-82 (N terminal).
    Sequence:

    MADWARAQSPGAVEEILDRENKRMADSLASKVTRLKSLALDIDRDAEDQN RYLDGMDSDFTSMTSLLTGSVKRFSTMARSGQ


    Database link: Q9NYM9

  • Positive control

    • Human stomach, human cell line U-2 OS.
  • General notes

    Previously labelled as BET1L. 

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at -20ºC.
  • Storage buffer

    pH: 7.20
    Preservative: 0.02% Sodium azide
    Constituents: 59% PBS, 40% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab122591 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/1000 - 1/2500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
ICC/IF Use a concentration of 1 - 4 µg/ml. The following steps are recommended prior to antibody incubation: cells fixation in ice cold 4% paraformaldehyde pH 7.2-7.3, followed by permeabilization with 0.1% Triton X-100 in PBS for 3x5 minutes.

Target

  • Function

    Vesicle SNARE required for targeting and fusion of retrograde transport vesicles with the Golgi complex. Required for the integrity of the Golgi complex.
  • Sequence similarities

    Contains 1 t-SNARE coiled-coil homology domain.
  • Cellular localization

    Golgi apparatus membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • BET1-like protein antibody
    • BET1L antibody
    • BET1L_HUMAN antibody
    • Golgi SNARE with a size of 15 kDa antibody
    • GOLIM3 antibody
    • GOS-15 antibody
    • GS15 antibody
    • Vesicle transport protein GOS15 antibody
    see all

Images

  • ab122591, at 1/1000 dilution, staining human stomach glandular cells by immunohistochemistry of paraffin embedded tissues (IHC-P).
  • ab122591, at 4µg/mL, staining human cell line U-2 OS by immunofluorescence (IF).

References

ab122591 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab122591.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up