Overview

  • Product name

  • Description

    Rabbit polyclonal to GSAP
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Human GSAP aa 616-854. (Expressed in E.coli).
    Sequence:

    DHFLRHLQGVEKKKIEQMVLDYISKLLDLICHIVETNWRKHNLHSWVLHF NSRGSAAEFAVFHIMTRILEATNSLFLPLPPGFHTLHTILGVQCLPLHNL LHCIDSGVLLLTETAVIRLMKDLDNTEKNEKLKFSIIVRLPPLIGQKICR LWDHPMSSNIISRNHVTRLLQNYKKQPRNSMINKSSFSVEFLPLNYFIEI LTDIESSNQALYPFEGHDNVDAEFVEEAALKHTAMLLGL


    Database link: A4D1B5

  • Positive control

    • WB: Human serum; Recombinant human GSAP protein. IHC-P: Human prostate and prostate cancer tissues.
  • General notes

    Previously labelled as PION.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    ab233435 was purified by antigen-specific affinity chromatography followed by Protein A affinity chromatography.
  • Clonality

    Polyclonal
  • Isotype

    IgG

Applications

Our Abpromise guarantee covers the use of ab233435 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 98 kDa.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

  • Function

    Regulator of gamma-secretase activity, which specifically activates the production of beta-amyloid protein (beta-amyloid protein 40 and beta-amyloid protein 42), without affecting the cleavage of other gamma-secretase targets such has Notch. The gamma-secretase complex is an endoprotease complex that catalyzes the intramembrane cleavage of integral membrane proteins such as Notch receptors and APP (beta-amyloid precursor protein). Specifically promotes the gamma-cleavage of APP CTF-alpha (also named APP-CTF) by the gamma-secretase complex to generate beta-amyloid, while it reduces the epsilon-cleavage of APP CTF-alpha, leading to a low production of AICD.
  • Tissue specificity

    Widely expressed.
  • Sequence similarities

    Belongs to the GSAP family.
  • Post-translational
    modifications

    The protein is first synthesized as a holoprotein form of 98 kDa and rapidly processed into the gamma-secretase-activating protein 16 kDa C-terminal form, which constitutes the predominant form.
  • Cellular localization

    Golgi apparatus > trans-Golgi network.
  • Information by UniProt
  • Database links

  • Alternative names

    • A530088I07Rik antibody
    • DKFZp667B242 antibody
    • Gamma-secretase-activating protein 16 kDa C-terminal form antibody
    • GSAP antibody
    • GSAP-16K antibody
    • GSAP_HUMAN antibody
    • MGC126548 antibody
    • Pigeon homolog (Drosophila) antibody
    • Pion antibody
    • Protein pigeon homolog antibody
    • tcag7.1314 antibody
    see all

Images

  • Formalin-fixed, paraffin-embedded human prostate tissue stained for GSAP using ab233435 at 10 µg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded human prostate cancer tissue stained for GSAP using ab233435 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Anti-GSAP antibody (ab233435) at 5 µg/ml + Human serum

    Predicted band size: 98 kDa

  • Anti-GSAP antibody (ab233435) at 2 µg/ml + Recombinant human GSAP protein

    Predicted band size: 98 kDa

References

ab233435 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab233435.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up