
  • Product name

  • Description

    Rabbit polyclonal to GSH2
  • Host species

  • Specificity

    ab26255 recognises GSH2 protein.
  • Tested applications

    Suitable for: ELISA, WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Guinea pig, Cow, Cat, Dog, Pig
  • Immunogen

    Synthetic peptide within Human GSH2 aa 1-50 (N terminal). The exact sequence is proprietary.


    Database link: Q9BZM3

  • Positive control

    • Fetal liver lysate, human kidney cell


  • Form

  • Storage instructions

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
  • Storage buffer

    Preservative: 0.09% Sodium azide
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

  • Isotype

  • Research areas


Our Abpromise guarantee covers the use of ab26255 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ELISA 1/62500.
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 32 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.
IHC-P Use at an assay dependent concentration.



  • Staining of human kidney tissue with ab26255 at a concentration of 4-8 ug/ml. Positive labelled epithelial cells of renal tubule are indicated with arrows. 400X magnification.
  • Ab26255 (0.5 ug/ml) staining of GSX2 in fetal liver cell lysate by Western Blot. Suggested dilution at 0.5µg/ml in 5% skim milk / PBS buffer, and HRP conjugated anti-Rabbit IgG should be diluted in 1: 50,000 - 100,000 as second antibody.
  • Immunohistochemistry of Brain, cortex tissue at an antibody concentration of 5µg/ml using anti-GSH2 antibody (ab26255)


This product has been referenced in:

  • Pi Z  et al. Isoflurane reduces pain and inhibits apoptosis of myocardial cells through the phosphoinositide 3-kinase/protein kinase B signaling pathway in mice during cardiac surgery. Mol Med Rep 17:6497-6505 (2018). Read more (PubMed: 29488606) »
  • Wang Q  et al. Resistant starch prevents tumorigenesis of dimethylhydrazine-induced colon tumors via regulation of an ER stress-mediated mitochondrial apoptosis pathway. Int J Mol Med 41:1887-1898 (2018). Read more (PubMed: 29393371) »
See all 5 Publications for this product

Customer reviews and Q&As


Thank you for your enquiry. Although we cannot disclose the peptide sequence used to generate this antibody, we can provide you with a 50 amino acid region from which the sequence was derived. This region is as follows: MSRSFYVDSLIIKDTSRPAPSLPEPHPGPDFFIPLGMPPPLVMSVSGPGC. The percentage homology between the immunogen peptide sequence and the mouse Gsh2 is 92%. We do not sell or provide free aliquots of the antibody for testing. If you do decide to try the antibody on this untested species, we encourage you to submit a review of your results, positive or negative, in the form of an Abreview. Details of our Abreview program can be found on our homepage. If we publish your review, you will be awarded credits towards future purchases or gifts. I hope this answers your questions. Feel free to contact me if you have further questions and I will be happy to assist you.

Read More

For licensing inquiries, please contact partnerships@abcam.com

Sign up