Overview

  • Product name

    Anti-GST-1 antibody
  • Description

    Rabbit polyclonal to GST-1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
  • Immunogen

    Recombinant fragment corresponding to Human GST-1 aa 305-397.
    Sequence:

    LARNPMKKTEEIYGFLGIPLDSHVARWIQNNTRGDPTLGKHKYGTVRNSA ATAEKWRFRLSYDIVAFAQNACQQVLAQLGYKIAASEEELKNP


    Database link: O43916

  • Positive control

    • WB: HL-60 whole cell lysate; Mouse brain lysate; Rat heart lysate. IHC-P: Human brain tissue.
  • General notes

    Previously labelled as Carbohydrate sulfotransferase 1.

Properties

Applications

Our Abpromise guarantee covers the use of ab224622 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/5000. Detects a band of approximately 47 kDa (predicted molecular weight: 47 kDa).
IHC-P 1/20 - 1/200.

Target

  • Function

    Catalyzes the transfer of sulfate to position 6 of galactose (Gal) residues of keratan. Has a preference for sulfating keratan sulfate, but it also transfers sulfate to the unsulfated polymer. The sulfotransferase activity on sialyl LacNAc structures is much higher than the corresponding desialylated substrate, and only internal Gal residues are sulfated. May function in the sulfation of sialyl N-acetyllactosamine oligosaccharide chains attached to glycoproteins. Participates in biosynthesis of selectin ligands. Selectin ligands are present in high endothelial cells (HEVs) and play a central role in lymphocyte homing at sites of inflammation.
  • Tissue specificity

    Widely expressed at low level. Expressed in brain and skeletal muscle. Expressed by high endothelial cells (HEVs) and leukocytes.
  • Sequence similarities

    Belongs to the sulfotransferase 1 family. Gal/GlcNAc/GalNAc subfamily.
  • Cellular localization

    Golgi apparatus membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • Carbohydrate chondroitin 6 keratan sulfotransferase 1 antibody
    • Carbohydrate chondroitin 6 keratan sulfotransferase antibody
    • Carbohydrate keratan sulfate Gal 6 sulfotransferase antibody
    • Carbohydrate keratan sulfate Gal 6 sulfotransferase 1 antibody
    • Carbohydrate sulfotransferase 1 antibody
    • Chst1 antibody
    • CHST1_HUMAN antibody
    • EC 2.8.2.21 antibody
    • Galactose N acetylglucosamine N acetylglucosamine 6 O sulfotransferase 1 antibody
    • Galactose/N-acetylglucosamine/N-acetylglucosamine 6-O-sulfotransferase 1 antibody
    • GST 1 antibody
    • GST-1 antibody
    • Keratan sulfate Gal 6 sulfotransferase antibody
    • Keratan sulfate Gal-6 sulfotransferase antibody
    • KS6ST antibody
    • KSGal6ST antibody
    • KSST antibody
    see all

Images

  • Paraffin-embedded human brain tissue stained for GST-1 using ab224622 at 1/100 dilution in immunohistochemical analysis.

  • All lanes : Anti-GST-1 antibody (ab224622) at 1/500 dilution

    Lane 1 : HL-60 (human promyelocytic leukemia cell line) whole cell lysate
    Lane 2 : Mouse brain lysate
    Lane 3 : Rat heart lysate

    Secondary
    All lanes : Goat polyclonal to rabbit IgG at 1/50000 dilution

    Predicted band size: 47 kDa
    Observed band size: 47 kDa

References

ab224622 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224622.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up