Anti-GST antibody [3G10/1B3] (ab92)

Thank you for your enquiry and your interest in our products.

I can confirm that we sell this antibody in liquid format, the unit size is 100 µg the concentration is 1 mg/ml.

If you need any further assistance in the future, please do not hesitate to contact me

I am very glad to hear that our anti-Beta Actin loading control has worked so well for you.

In regards to a loading control for your current needs, Beta Actin would only be present in serum if shearing of cells had occurred during collection so this would not make a viable control. I have come across data stating that tranferrin and alpha anti-Trypsin are usually expressed at levels ˜2.5mg/ml and ˜1.3mg/ml respectively. However, as these may vary in samples, it may be best to add a purified peptide such a GST to your sample and stain against that.

We do offer antibodies against Transferrin, alpha anti-Trypsin and GST as well as purified GST peptides.

GST (ab70456):https://www.abcam.com/GST-protein-ab70456.html

anti-GST antibody (ab92):https://www.abcam.com/GST-antibody-3G10-1B3-ab92.html

anti-alpha-anti-Trypsin antibody (ab7633):https://www.abcam.com/alpha-1-Antitrypsin-antibody-ab7633.html

anti-Tranferrin antibody (ab1223):https://www.abcam.com/Transferrin-antibody-ab1223.html



I hope that this information is helpful. Please let me know if you have any questions or there are other ways that Abcam may help you meet your research goals.

I'm sorry to hear you are experiencing problems with ab92. I have been able to source the images from the laboratory and have added them to the datasheet, interestingly the band we get with a HeLa whole cell lysate is also large ("fat") in a similar way to your blot so it may be that the protein's migration properties give this pattern. I enclose below other possible reasons for the problem which accentuate the band fuzziness: 1) too little Tween20 in the buffer: I would recommend adding more Tween20 to the antibody dilution buffer/washing buffer (0.1%v/v) and using a Tris based buffer rather than PBS as Tris gives sharper bands. 2) the percentage of SDS/methanol in the migration buffer and transfer buffer respectively can be a problem (SDS percentage should be around 1%w/v and should be fresh SDS, methanol percentage should be 20%v/v). The stacking gel composition can give problems with small proteins and resolution of small proteins often does not give as sharp a band as large proteins. 3) the blocking buffer can also sometimes give problems to the antibody and prevent it from binding correctly. I suggest trying 1hr milk 5% and incubation of the antibody in TBST only and also try 5%BSA the same way. 3) the lysis buffer (NETT buffer) may not be the most suitable extraction buffer for the protein. We do not have experience of this buffer and I would recommend trying a 20 mM Tris-HCl, pH 7.5 1 mM EGTA buffer or a NP40/RIPA buffer (50mM Tris HCl pH 8, 150 mM NaCl, 1 % NP-40, 0.5 % sodium Deoxycholate, 0.1 % SDS). 4) Finally, we have had good results with even more dilute antibody (0.5ug/ml equivalent to 1:2000) therefore you may find that by diluting the antibody more (and with the change in blocking buffer) and incubating at 4C overnight as you have previously done this will improve the signal (even if you need to expose the blot longer). I hope these suggestions will help you, please do not hesitate to contact me if you require further assistance,

Thanks again for your email. We do not routinely offer free or trial sized samples for testing purposes. Our policy at Abcam is that if an antibody does not work as specified on the datasheet, we will offer a replacement or reimbursement. Should you decide to test an antibody in an application for which we do not have any information, please let us know how you get on and in return we will award you 50 points with the Abcam Loyalty Scheme which can be redeemed on a number of rewards. Regarding a catalogue, we don't have a traditional "paper" catalogue as all of our items are listed online on our website www.abcam.com Please let me know if you have any additional questions.

Thank you for enquiry. I have checked with the originator of this antibody and there was a mistake regarding the immunogen on the datasheet. This antibody was generated as a bi-product during a fusion. The original immunogen was a GST fusion protein, with the total fusion protein being 425 amino acids. The actual GST portion is 232 amino acids: MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLIEGRGIPGNSS Unfortunately I am unable to share what the protein fragment was that was fused to GST during the generation of this particular clone due to confidentiality reasons. I can say is that it was a small fragment of a very high molecular weight protein. I have updated the datasheet to reflect this information and apologize for the inconvenience. If you have any additional questions, please contact us again.