Overview

  • Product name

    Anti-GST3 / GST pi antibody
    See all GST3 / GST pi primary antibodies
  • Description

    Rabbit polyclonal to GST3 / GST pi
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Pig
  • Immunogen

    Recombinant full length protein (His-T7-tag) corresponding to Pig GST3/ GST pi aa 1-207. (Expressed in E.coli).
    Sequence:

    PPYTITYFPVRGRCEAMRMLLADQDQSWKEEVVTMETWPPLKPSCLFRQL PKFQDGDLTLYQSNAILRHLGRSFGLYGKDQKEAALVDMVNDGVEDLRCK YATLIYTNYEAGKEKYVKELPEHLKPFETLLSQNQGGQAFVVGSQISFAD YNLLDLLRIHQVLNPSCLDAFPLLSAYVARLSARPKIKAFLASPEHVNRP INGNGKN


    Database link: P80031

  • Positive control

    • WB: Recombinant pig GST3 / GST pi protein; Pig skin, stomach and pancreas lysates.

Properties

Applications

Our Abpromise guarantee covers the use of ab231569 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 23 kDa.

Target

  • Function

    Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles.
  • Sequence similarities

    Belongs to the GST superfamily. Pi family.
    Contains 1 GST C-terminal domain.
    Contains 1 GST N-terminal domain.
  • Information by UniProt
  • Database links

  • Alternative names

    • Deafness antibody
    • Deafness X-linked 7 antibody
    • DFN7 antibody
    • FAEES3 antibody
    • Fatty Acid Ethyl Ester Synthase III antibody
    • Glutathione S Transferase 3 antibody
    • Glutathione S Transferase Pi antibody
    • Glutathione S-transferase P antibody
    • Glutathione S-transferase pi 1 antibody
    • GST class-pi antibody
    • GST3 antibody
    • GSTP antibody
    • Gstp1 antibody
    • GSTP1-1 antibody
    • GSTP1_HUMAN antibody
    • PI antibody
    • X linked 7 antibody
    see all

Images

  • Anti-GST3 / GST pi antibody (ab231569) at 2 µg/ml + Recombinant pig GST3 / GST pi protein

    Predicted band size: 23 kDa

  • Anti-GST3 / GST pi antibody (ab231569) at 2 µg/ml + Pig skin lysate

    Predicted band size: 23 kDa

  • Anti-GST3 / GST pi antibody (ab231569) at 2 µg/ml + Pig stomach lysate

    Predicted band size: 23 kDa

References

ab231569 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231569.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up