Overview

  • Product name

  • Description

    Rabbit polyclonal to GSTA2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse
    Predicted to work with: Rat
  • Immunogen

    Recombinant full length protein (His-T7-tag) corresponding to Mouse GSTA2 aa 1-222. (Expressed in E.coli).
    Sequence:

    MAGKPVLHYFNARGRMECIRWLLAAAGVEFEEKFIQSPEDLEKLKKDGNL MFDQVPMVEIDGMKLVQTRAILNYIATKYDLYGKDMKERALIDMYTEGIL DLTEMIGQLVLCPPDQREAKTALAKDRTKNRYLPAFEKVLKSHGQDYLVG NRLTRVDVHLLELLLYVEELDASLLTPFPLLKAFKSRISSLPNVKKFLHP GSQRKPPLDAKQIEEARKVFKF


    Database link: P10648

  • Positive control

    • WB: Recombinant mouse GSTA2 protein; Mouse liver lysate. IHC-P: Mouse kidney tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.4
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    Antigen-specific affinity chromatography followed by Protein A affinity chromatography.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab232833 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 - 20 µg/ml.
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 26 kDa.

Target

  • Relevance

    Cytosolic and membrane-bound forms of glutathione S-transferase are encoded by two distinct supergene families. These enzymes are involved in cellular defense against toxic, carcinogenic, and pharmacologically active electrophilic compounds. At present, eight distinct classes of the soluble cytoplasmic mammalian glutathione S-transferases have been identified: alpha, kappa, mu, omega, pi, sigma, theta and zeta. This gene encodes a glutathione S-tranferase belonging to the alpha class. The alpha class genes, which are located in a cluster on chromosome 6, are highly related and encode enzymes with glutathione peroxidase activity that function in the detoxification of lipid peroxidation products. Reactive electrophiles produced by oxidative metabolism have been linked to a number of degenerative diseases including Parkinson's disease, Alzheimer's disease, cataract formation, and atherosclerosis.
  • Cellular localization

    Cytoplasmic
  • Database links

  • Alternative names

    • EC 2.5.1.18 antibody
    • Glutathione S transferase 2 antibody
    • Glutathione S transferase A2 antibody
    • Glutathione S-alkyltransferase A2 antibody
    • Glutathione S-aralkyltransferase A2 antibody
    • Glutathione S-aryltransferase A2 antibody
    • Glutathione S-transferase alpha 2 antibody
    • Glutathione S-transferase GT41A antibody
    • Glutathione S-transferase Ya-2 antibody
    • Glutathione S-transferase, alpha 2 (Yc2) antibody
    • GST 1b-1b antibody
    • GST A2-2 antibody
    • GST class alpha member 2 antibody
    • GST gamma antibody
    • GST HA subunit 2 antibody
    • GST Ya2 antibody
    • GST, class alpha, 2 antibody
    • GST2 antibody
    • Gst2-2 antibody
    • GSTA2 2 antibody
    • GSTA2-2 antibody
    • Gstc-2 antibody
    • Gstc2 antibody
    • GTA2 antibody
    • GTH2 antibody
    • HA subunit 2 antibody
    • Liver GST2 antibody
    • MGC10525 antibody
    • OTTHUMP00000017883 antibody
    • S-(hydroxyalkyl)glutathione lyase A2 antibody
    see all

Images

  • Formalin-fixed, paraffin-embedded mouse kidney tissue stained for GSTA2 using ab232833 at 10 µg/ml in immunohistochemical analysis. DAB staining.

  • Anti-GSTA2 antibody (ab232833) at 2 µg/ml + Mouse liver lysate

    Predicted band size: 26 kDa

  • Anti-GSTA2 antibody (ab232833) at 2 µg/ml + Recombinant mouse GSTA2 protein

    Predicted band size: 26 kDa

References

ab232833 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab232833.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up