Overview

  • Product name

    Anti-GSTA3 antibody [9#]
    See all GSTA3 primary antibodies
  • Description

    Mouse monoclonal [9#] to GSTA3
  • Host species

    Mouse
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant full length protein (His-tag) corresponding to Human GSTA3 aa 1-222. N-terminal tag (Expressed in E.coli).
    Sequence:

    MAGKPKLHYFNGRGRMEPIRWLLAAAGVEFEEKFIGSAEDLGKLRNDGSL MFQQVPMVEIDGMKLVQTRAILNYIASKYNLYGKDIKERALIDMYTEGMA DLNEMILLLPLCRPEEKDAKIALIKEKTKSRYFPAFEKVLQSHGQDYLVG NKLSRADISLVELLYYVEELDSSLISNFPLLKALKTRISNLPTVKKFLQP GSPRKPPADAKALEEARKIFRF


    Database link: Q16772

  • Positive control

    • WB: Recombinant human GSTA3 protein; Human liver lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab239478 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.5 - 5 µg/ml. Predicted molecular weight: 25 kDa.

Target

  • Function

    Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles. Catalyzes isomerization reactions that contribute to the biosynthesis of steroid hormones. Efficiently catalyze obligatory double-bond isomerizations of delta(5)-androstene-3,17-dione and delta(5)-pregnene-3,20-dione, precursors to testosterone and progesterone, respectively.
  • Sequence similarities

    Belongs to the GST superfamily. Alpha family.
    Contains 1 GST C-terminal domain.
    Contains 1 GST N-terminal domain.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt
  • Database links

  • Alternative names

    • Glutathione S alkyltransferase A3 antibody
    • Glutathione S aralkyltransferase A3 antibody
    • Glutathione S aryltransferase A3 antibody
    • Glutathione S transferase A3 3 antibody
    • Glutathione S transferase A3 antibody
    • glutathione S transferase A3 subunit antibody
    • Glutathione S transferase alpha 3 antibody
    • Glutathione S transferase alpha type (Ya) antibody
    • glutathione S transferase Yc 1 antibody
    • glutathione S transferase Yc1 subunit antibody
    • Glutathione S-transferase A3 antibody
    • Glutathione S-transferase A3-3 antibody
    • Glutathione S-transferase Ya3 antibody
    • Glutathione S-transferase Yc antibody
    • glutathione transferase A3 subunit antibody
    • Glutathione transferase alpha 3 antibody
    • GST 2 2 antibody
    • GST AA antibody
    • GST class alpha antibody
    • GST class alpha member 3 antibody
    • GST class-alpha member 3 antibody
    • GST Yc1 antibody
    • GSTA 3 antibody
    • GSTA3 3 antibody
    • Gsta3 antibody
    • GSTA3-3 antibody
    • GSTA3_HUMAN antibody
    • Gstyc antibody
    • GTA 3 antibody
    • GTA3 antibody
    • MGC22232 antibody
    • S (hydroxyalkyl)glutathione lyase A3 antibody
    • Yc1 antibody
    see all

Images

  • Anti-GSTA3 antibody [9#] (ab239478) at 2 µg/ml + Recombinant human GSTA3 protein

    Secondary
    HRP-Linked Rabbit Anti-Mouse IgG at 1/5000 dilution

    Predicted band size: 25 kDa

  • Anti-GSTA3 antibody [9#] (ab239478) at 2 µg/ml + Human liver lysate

    Secondary
    HRP-Linked Rabbit Anti-Mouse IgG at 1/5000 dilution

    Predicted band size: 25 kDa

References

ab239478 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab239478.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up