Overview

  • Product name

  • Description

    Rabbit polyclonal to GSTA4
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Rat
    Predicted to work with: Mouse
  • Immunogen

    Recombinant full length protein (His-T7-tag) corresponding to Rat GSTA4 aa 2-222. Expressed in E.coli. N-terminal tags.
    Sequence:

    MGSSHHHHHHSSGLVPRGSHMASMTGGQQMGRGSEVKPKLYYFQGRGRME SIRWLLATAGVEFEEEFLETREQYEKLQKDGCLLFGQVPLVEIDGMLLTQ TRAILSYLAAKYNLYGKDLKERVRIDMYADGTQDLMMMIIGAPFKAPQEK EESLALAVKRAKNRYFPVFEKILKDHGEAFLVGNQLSWADIQLLEAILMV EEVSAPVLSDFPLLQAFKTRISNIPTIKKFLQPGSQRKPPPDGHYVDVVR TVLKF


    Database link: P14942

  • Positive control

    • WB: Recombinant rat GSTA4 protein; rat serum; rat brain and liver lysates. IHC-P: Rat colon, testis, kidney, lung and liver tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab231601 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 - 20 µg/ml.
WB Use a concentration of 0.5 - 2 µg/ml. Predicted molecular weight: 26 kDa.

Target

  • Function

    Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles. This isozyme has a high catalytic efficiency with 4-hydroxyalkenals such as 4-hydroxynonenal (4-HNE).
  • Tissue specificity

    Expressed at a high level in brain, placenta, and skeletal muscle and much lower in lung and liver.
  • Sequence similarities

    Belongs to the GST superfamily. Alpha family.
    Contains 1 GST C-terminal domain.
    Contains 1 GST N-terminal domain.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt
  • Database links

  • Alternative names

    • DKFZp686D21185 antibody
    • Glutathione S alkyltransferase A4 antibody
    • Glutathione S aralkyltransferase A4 antibody
    • Glutathione S aryltransferase A4 antibody
    • Glutathione S transferase A4 4 antibody
    • Glutathione S transferase A4 antibody
    • Glutathione S transferase alpha 4 antibody
    • Glutathione S-transferase A4 antibody
    • Glutathione S-transferase A4-4 antibody
    • Glutathione transferase A4 4 antibody
    • GST class alpha member 4 antibody
    • GST class-alpha member 4 antibody
    • GSTA4 4 antibody
    • GSTA4 antibody
    • GSTA4_HUMAN antibody
    • GTA4 antibody
    • OTTHUMP00000016624 antibody
    • OTTHUMP00000016625 antibody
    • S (hydroxyalkyl)glutathione lyase A4 antibody
    see all

Images

  • All lanes : Anti-GSTA4 antibody (ab231601) at 3 µg/ml

    Lane 1 : Rat serum
    Lane 2 : Rat brain lysate
    Lane 3 : Rat liver lysate

    Secondary
    All lanes : HRP-Linked Guinea pig anti-Rabbit at 1/2000 dilution

    Predicted band size: 26 kDa

  • Formalin-fixed, paraffin-embedded rat colon tissue stained for GSTA4 using ab231601 at 20 μg/ml in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded rat testis tissue stained for GSTA4 using ab231601 at 20 μg/ml in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded rat kidney tissue stained for GSTA4 using ab231601 at 20 μg/ml in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded rat liver tissue stained for GSTA4 using ab231601 at 20 μg/ml in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded rat lung tissue stained for GSTA4 using ab231601 at 20 μg/ml in immunohistochemical analysis. DAB staining.

  • Anti-GSTA4 antibody (ab231601) at 3 µg/ml + Recombinant rat GSTA4 protein

    Secondary
    HRP-Linked Guinea pig anti-Rabbit at 1/2000 dilution

    Predicted band size: 26 kDa

References

ab231601 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231601.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up