Overview

  • Product name

  • Description

    Rabbit polyclonal to GSTA4
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Cow
  • Immunogen

    Recombinant fragment corresponding to Human GSTA4 aa 93-222.
    Sequence:

    DMYVEGTLDLLELLIMHPFLKPDDQQKEVVNMAQKAIIRYFPVFEKILRG HGQSFLVGNQLSLADVILLQTILALEEKIPNILSAFPFLQEYTVKLSNIP TIKRFLEPGSKKKPPPDEIYVRTVYNIFRP


    Database link: O15217

  • Positive control

    • IHC-P: Human lung cancer tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab238608 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.

Target

  • Function

    Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles. This isozyme has a high catalytic efficiency with 4-hydroxyalkenals such as 4-hydroxynonenal (4-HNE).
  • Tissue specificity

    Expressed at a high level in brain, placenta, and skeletal muscle and much lower in lung and liver.
  • Sequence similarities

    Belongs to the GST superfamily. Alpha family.
    Contains 1 GST C-terminal domain.
    Contains 1 GST N-terminal domain.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt
  • Database links

  • Alternative names

    • DKFZp686D21185 antibody
    • Glutathione S alkyltransferase A4 antibody
    • Glutathione S aralkyltransferase A4 antibody
    • Glutathione S aryltransferase A4 antibody
    • Glutathione S transferase A4 4 antibody
    • Glutathione S transferase A4 antibody
    • Glutathione S transferase alpha 4 antibody
    • Glutathione S-transferase A4 antibody
    • Glutathione S-transferase A4-4 antibody
    • Glutathione transferase A4 4 antibody
    • GST class alpha member 4 antibody
    • GST class-alpha member 4 antibody
    • GSTA4 4 antibody
    • GSTA4 antibody
    • GSTA4_HUMAN antibody
    • GTA4 antibody
    • OTTHUMP00000016624 antibody
    • OTTHUMP00000016625 antibody
    • S (hydroxyalkyl)glutathione lyase A4 antibody
    see all

Images

  • Paraffin-embedded human lung cancer tissue stained for GSTA4 using ab238608 at 1/100 dilution in immunohistochemical analysis.

References

ab238608 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab238608.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up