Overview

  • Product name

  • Description

    Rabbit polyclonal to GSTA5
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Rat, Human
  • Immunogen

    Recombinant full length protein (His-tag) corresponding to Rat GSTA5 aa 1-221. Expressed in E. coli. N-terminal tag.
    Sequence:

    MPGKPVLHYFDGRGRMEPIRWLLAAAGVEFEENFLKTRDDLARLRSDGSL MFEQVPMVEIDGMKLVQTKAILNYIATKYNLYGKDMKERALIDMYAEGVA DLELMVLYYPYMPPGEKEASLAKIKDKARNRYFPAYEKVLKSHGQDYLVG NKLSRADVSLVELLYHVEEMDPGIVDNFPLLKALRTRVSNLPTVKKFLQP GSQRKPFDDEKCVESAKKIFS


    Database link: P46418

  • Positive control

    • WB: Recombinant rat GSTA5 protein; rat and human liver tissue lysate. IHC-P: Rat liver and kidney tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.4
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Protein A purified
  • Purification notes

    Antigen-specific affinity chromatography followed by Protein A affinity chromatography.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab232871 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 - 20 µg/ml.
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 25 kDa.

Target

  • Tissue specificity

    Expression not detected.
  • Sequence similarities

    Belongs to the GST superfamily. Alpha family.
    Contains 1 GST C-terminal domain.
    Contains 1 GST N-terminal domain.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt
  • Database links

  • Alternative names

    • glutathione S transferase alpha 5 antibody
    • glutathione S transferase Yc 2 antibody
    • Glutathione S-transferase A5 antibody
    • Glutathione S-transferase A5-5 antibody
    • Glutathione transferase A5 antibody
    • GST A5 5 antibody
    • GST class-alpha member 5 antibody
    • GST Yc2 antibody
    • GSTA5 antibody
    • Gsta5 glutathione S transferase Yc2 subunit antibody
    • GSTA5_HUMAN antibody
    see all

Images

  • Anti-GSTA5 antibody (ab232871) at 2 µg/ml + Rat liver tissue lysate

    Secondary
    HRP-Linked Goat anti-Rabbit IgG polyclonal at 0.2 µg/ml

    Predicted band size: 25 kDa

  • Formalin-fixed, paraffin-embedded rat liver tissue stained for GSTA5 using ab232810 at 20 μg/ml in immunohistochemical analysis.

    Secondary used: HRP-Linked Goat anti-Rabbit IgG polyclonal at 2 µg/ml. DAB staining.

  • Formalin-fixed, paraffin-embedded rat kidney tissue stained for GSTA5 using ab232810 at 20 μg/ml in immunohistochemical analysis.

    Secondary used: HRP-Linked Goat anti-Rabbit IgG polyclonal at 2 µg/ml. DAB staining.

  • Anti-GSTA5 antibody (ab232871) at 2 µg/ml + Human liver tissue lysate

    Secondary
    HRP-Linked Goat anti-Rabbit IgG polyclonal at 0.2 µg/ml

    Predicted band size: 25 kDa

  • Anti-GSTA5 antibody (ab232871) at 2 µg/ml + Recombinant rat GSTA5

    Predicted band size: 25 kDa

References

ab232871 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab232871.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up