For the best experience on the Abcam website please upgrade to a modern browser such as Google Chrome

We use cookies to make our site as useful as possible.

Our Cookie Policy explains how you can opt-out of the cookies we use.

If you continue without changing your cookie settings, we'll assume you’re happy with this.

Continue Continue

United States
Your country/region is currently set to:

If incorrect, please enter your country/region into the box below, to view site information related to your country/region.

Call (888) 77-ABCAM (22226) or contact us
Need help? Contact us

  • My account
  • Sign out
Sign in or Register with us

Welcome

Sign in or

Don't have an account?

Register with us
My basket
Quick order
Abcam homepage

  • Research Products
    By product type
    Primary antibodies
    Secondary antibodies
    ELISA and Matched Antibody Pair Kits
    Cell and tissue imaging tools
    Cellular and biochemical assays
    Proteins and Peptides
    By product type
    Proteomics tools
    Agonists, activators, antagonists and inhibitors
    Cell lines and Lysates
    Multiplex miRNA assays
    Multiplex Assays
    By research area
    Cancer
    Cardiovascular
    Cell Biology
    Epigenetics
    Metabolism
    Developmental Biology
    By research area
    Immunology
    Microbiology
    Neuroscience
    Signal Transduction
    Stem Cells
  • Diagnostic & Therapeutic Solutions
    Custom solutions & partnerships

    Custom antibody development and commercial partnerships to advance your diagnostic and therapeutic discovery.

    Create custom solutions with us

    Partner with us

  • Support
    Support hub

    Access advice and support for any research roadblock

    View support hub

    Protocols

    Your experiments laid out step by step

    View protocols

  • Events
    • Conference calendar
    • Cancer
    • Cardiovascular
    • Epigenetics & Nuclear signaling
    • Immunology
    • Neuroscience
    • Stem cells
    • Tradeshows
    • Scientific webinars
    Keep up to date with the latest events

    Full event breakdown with abstracts, speakers, registration and more

    View global event calendar

  • Pathways
    Cell signalling pathways

    View all pathways

    View all interactive pathways

Supporting our customers and employees during the COVID-19 pandemic. Read more

  1. Link

    gstk1-antibody-ab231549.pdf

  1. Send me a copy of this email
    I agree to the terms and conditions.
Tags & Cell Markers Subcellular Markers Organelles Mitochondria
Share by email

Anti-GSTK1 antibody (ab231549)

  • Datasheet
Reviews (1) Submit a question

Product price, shipping and contact information

Currently unavailable

Sorry, we can't display this right now.

Please contact us to place your order, or try again later.

 

Loading size & price…

 

Shipping and order information

Abpromise

Guaranteed product quality, expert customer support.

Find out more.

Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-GSTK1 antibody (ab231549)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-GSTK1 antibody (ab231549)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-GSTK1 antibody (ab231549)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-GSTK1 antibody (ab231549)
  • Western blot - Anti-GSTK1 antibody (ab231549)
  • Western blot - Anti-GSTK1 antibody (ab231549)

Key features and details

  • Rabbit polyclonal to GSTK1
  • Suitable for: WB, IHC-P
  • Reacts with: Mouse, Human
  • Isotype: IgG

You may also be interested in

Secondary
Product image
Goat Anti-Rabbit IgG H&L (HRP) (ab205718)
Protein
Product image
Recombinant Human GSTK1 protein (ab206453)

View more associated products

Overview

  • Product name

    Anti-GSTK1 antibody
    See all GSTK1 primary antibodies
  • Description

    Rabbit polyclonal to GSTK1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Human
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Mouse GSTK1 aa 19-222. N-terminal tags. Expressed in E.coli.
    Sequence:

    SWLGFEVLCRYQHLWNIKLQLRPTLIAGIMKDSGNQPPAMVPRKGQYIFK EIPLLKQFFQVPLNIPKDFFGETVKKGSINAMRFLTTVSMEQPEMLEKVS REIWMRVWSRDEDITEYQSILAAAVKAGMSTAQAQHFLEKISTQQVKNKL IENTDAACKYGAFGLPTTVAHVDGKTYMLFGSDRLELLAYLLGEKWMGPV PPTA


    Database link: Q9DCM2
    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI
  • Positive control

    • IHC-P: Mouse liver, kidney, brain and stomach tissues. WB: HeLa and Raji cell lysates; Mouse liver and heart lysates; Recombinant human GSTK1 protein.
  • General notes

    Previously labelled as Glutathione S Transferase kappa 1. 

    Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.

    Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.

    We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.

    In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.

    We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.

    Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.

    Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    ab231549 was purified by antigen-specific affinity chromatography followed by Protein A affinity chromatography.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

    • Tags & Cell Markers
    • Subcellular Markers
    • Organelles
    • Mitochondria
    • Tags & Cell Markers
    • Subcellular Markers
    • Organelles
    • Peroxisome
    • Signal Transduction
    • Metabolism
    • Energy Metabolism
    • Signal Transduction
    • Metabolism
    • Mitochondrial
    • Signal Transduction
    • Metabolism
    • Drug metabolism
    • Cell Biology
    • Other Antibodies
    • Oxidative Stress
    • Metabolism
    • Pathways and Processes
    • Mitochondrial Metabolism
    • Mitochondrial markers
    • Metabolism
    • Pathways and Processes
    • Metabolic signaling pathways
    • Drug metabolism
    • Metabolism
    • Pathways and Processes
    • Metabolic signaling pathways
    • Energy transfer pathways
    • Energy Metabolism
    • Metabolism
    • Pathways and Processes
    • Redox metabolism
    • Oxidative stress

Associated products

  • Compatible Secondaries

    • Goat Anti-Rabbit IgG H&L (Alexa Fluor® 488) (ab150077)
    • Goat Anti-Rabbit IgG H&L (HRP) (ab205718)
  • Isotype control

    • Rabbit IgG, polyclonal - Isotype Control (ChIP Grade) (ab171870)
  • Positive Controls

    • HeLa whole cell lysate (ab150035)
    • Mouse liver tissue lysate - total protein (ab29301)
    • HeLa whole cell lysate (ab29545)
    • Raji whole cell lysate (ab30124)
    • Mouse heart normal tissue lysate - total protein (ab30291)
  • Recombinant Protein

    • Recombinant Human GSTK1 protein (ab206453)

Applications

Our Abpromise guarantee covers the use of ab231549 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.5 - 2 µg/ml. Predicted molecular weight: 26 kDa.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

  • Function

    Significant glutathione conjugating activity is found only with the model substrate, 1-chloro-2,4-dinitrobenzene (CDNB).
  • Tissue specificity

    Ubiquitous.
  • Sequence similarities

    Belongs to the GST superfamily. Kappa family.
  • Cellular localization

    Peroxisome.
  • Target information above from: UniProt accession Q9Y2Q3 The UniProt Consortium
    The Universal Protein Resource (UniProt) in 2010
    Nucleic Acids Res. 38:D142-D148 (2010) .

    Information by UniProt
  • Database links

    • Entrez Gene: 373156 Human
    • Entrez Gene: 76263 Mouse
    • Omim: 602321 Human
    • SwissProt: Q9Y2Q3 Human
    • SwissProt: Q9DCM2 Mouse
    • Unigene: 390667 Human
    • Unigene: 267014 Mouse
    • Alternative names

      • EC 2.5.1.18 antibody
      • Glutathione S Transferase kappa 1 antibody
      • Glutathione S transferase subunit 13 antibody
      • Glutathione S-transferase k1 antibody
      • Glutathione S-transferase kappa 1 antibody
      • Glutathione S-transferase subunit 13 antibody
      • Glutathione S-transferase subunit 13 homolog antibody
      • GST 13 13 antibody
      • GST 13-13 antibody
      • GST antibody
      • GST class kappa antibody
      • GST class-kappa antibody
      • GST13 antibody
      • GST13-13 antibody
      • GSTK1 1 antibody
      • Gstk1 antibody
      • GSTK1-1 antibody
      • GSTK1_HUMAN antibody
      • hGSTK1 antibody
      see all

    Images

    • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-GSTK1 antibody (ab231549)
      Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-GSTK1 antibody (ab231549)

      Paraffin-embedded mouse liver tissue stained for GSTK1 using ab231549 at 20 µg/ml in immunohistochemical analysis. DAB staining.

    • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-GSTK1 antibody (ab231549)
      Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-GSTK1 antibody (ab231549)

      Paraffin-embedded mouse kidney tissue stained for GSTK1 using ab231549 at 20 µg/ml in immunohistochemical analysis. DAB staining.

    • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-GSTK1 antibody (ab231549)
      Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-GSTK1 antibody (ab231549)

      Paraffin-embedded mouse brain tissue stained for GSTK1 using ab231549 at 20 µg/ml in immunohistochemical analysis. DAB staining.

    • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-GSTK1 antibody (ab231549)
      Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-GSTK1 antibody (ab231549)

      Paraffin-embedded mouse stomach tissue stained for GSTK1 using ab231549 at 20 µg/ml in immunohistochemical analysis. DAB staining.

    • Western blot - Anti-GSTK1 antibody (ab231549)
      Western blot - Anti-GSTK1 antibody (ab231549)
      All lanes : Anti-GSTK1 antibody (ab231549) at 3 µg/ml

      Lane 1 : HeLa (human epithelial cell line from cervix adenocarcinoma) cell lysate
      Lane 2 : Raji (human Burkitt's lymphoma cell line) cell lysate
      Lane 3 : Mouse liver lysate
      Lane 4 : Mouse heart lysate

      Secondary
      All lanes : HRP-Linked Guinea pig Anti-Rabbit at 1/2000 dilution

      Predicted band size: 26 kDa

    • Western blot - Anti-GSTK1 antibody (ab231549)
      Western blot - Anti-GSTK1 antibody (ab231549)
      Anti-GSTK1 antibody (ab231549) at 3 µg/ml + Recombinant human GSTK1 protein

      Secondary
      HRP-Linked Guinea pig Anti-Rabbit at 1/2000 dilution

      Predicted band size: 26 kDa

    Protocols

    To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.

    Click here to view the general protocols

    Datasheets and documents

    • Datasheet
  • References (0)

    Publishing research using ab231549? Please let us know so that we can cite the reference in this datasheet.

    ab231549 has not yet been referenced specifically in any publications.

    Customer reviews and Q&As

    Show All Reviews Q&A
    Submit a review Submit a question

    Immunohistochemistry (Frozen sections) abreview for Anti-GSTK1 antibody

    Inconclusive
    Abreviews
    Abreviews
    abreview image
    Application
    Immunohistochemistry (Frozen sections)
    Sample
    Mouse Tissue sections (Hippocampus (Neurons in the CA1 Region))
    Permeabilization
    Yes - 0,1% Triton in PBS
    Specification
    Hippocampus (Neurons in the CA1 Region)
    Blocking step
    Serum as blocking agent for 45 hour(s) and 0 minute(s) · Concentration: 10% · Temperature: 25°C
    Fixative
    Paraformaldehyde
    Read More

    Helena Lichtenfeld

    Verified customer

    Submitted Aug 31 2020

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com

    Get resources and offers direct to your inbox Sign up
    A-Z by research area
    • Cancer
    • Cardiovascular
    • Cell biology
    • Developmental biology
    • Epigenetics & Nuclear signaling
    • Immunology
    • Metabolism
    • Microbiology
    • Neuroscience
    • Signal transduction
    • Stem cells
    A-Z by product type
    • Primary antibodies
    • Secondary antibodies
    • Biochemicals
    • Isotype controls
    • Flow cytometry multi-color selector
    • Kits
    • Loading controls
    • Lysates
    • Peptides
    • Proteins
    • Slides
    • Tags and cell markers
    • Tools & Reagents
    Help & support
    • Support
    • Make an Inquiry
    • Protocols & troubleshooting
    • Placing an order
    • RabMAb products
    • Biochemical product FAQs
    • Training
    • Browse by Target
    Company
    • Corporate site
    • Investor relations
    • Company news
    • Careers
    • About us
    • Blog
    Events
    • Tradeshows
    • Conferences
    International websites
    • abcam.cn
    • abcam.co.jp

    Join with us

    • LinkedIn
    • facebook
    • Twitter
    • YouTube
    • Terms of sale
    • Website terms of use
    • Cookie policy
    • Privacy policy
    • Legal
    • Modern slavery statement
    © 1998-2021 Abcam plc. All rights reserved.