Anti-GSTK1 antibody (ab231549)
Key features and details
- Rabbit polyclonal to GSTK1
- Suitable for: WB, IHC-P
- Reacts with: Mouse, Human
- Isotype: IgG
Overview
-
Product name
Anti-GSTK1 antibody
See all GSTK1 primary antibodies -
Description
Rabbit polyclonal to GSTK1 -
Host species
Rabbit -
Tested applications
Suitable for: WB, IHC-Pmore details -
Species reactivity
Reacts with: Mouse, Human -
Immunogen
Recombinant fragment (His-T7-tag) corresponding to Mouse GSTK1 aa 19-222. N-terminal tags. Expressed in E.coli.
Sequence:SWLGFEVLCRYQHLWNIKLQLRPTLIAGIMKDSGNQPPAMVPRKGQYIFK EIPLLKQFFQVPLNIPKDFFGETVKKGSINAMRFLTTVSMEQPEMLEKVS REIWMRVWSRDEDITEYQSILAAAVKAGMSTAQAQHFLEKISTQQVKNKL IENTDAACKYGAFGLPTTVAHVDGKTYMLFGSDRLELLAYLLGEKWMGPV PPTA
Database link: Q9DCM2 -
Positive control
- IHC-P: Mouse liver, kidney, brain and stomach tissues. WB: HeLa and Raji cell lysates; Mouse liver and heart lysates; Recombinant human GSTK1 protein.
-
General notes
Previously labelled as Glutathione S Transferase kappa 1.
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.40
Preservative: 0.02% Sodium azide
Constituents: PBS, 50% Glycerol -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Purification notes
ab231549 was purified by antigen-specific affinity chromatography followed by Protein A affinity chromatography. -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
-
Recombinant Protein
Applications
Our Abpromise guarantee covers the use of ab231549 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB | Use a concentration of 0.5 - 2 µg/ml. Predicted molecular weight: 26 kDa. | |
IHC-P | Use a concentration of 5 - 20 µg/ml. |
Target
-
Function
Significant glutathione conjugating activity is found only with the model substrate, 1-chloro-2,4-dinitrobenzene (CDNB). -
Tissue specificity
Ubiquitous. -
Sequence similarities
Belongs to the GST superfamily. Kappa family. -
Cellular localization
Peroxisome. - Information by UniProt
-
Database links
- Entrez Gene: 373156 Human
- Entrez Gene: 76263 Mouse
- Omim: 602321 Human
- SwissProt: Q9Y2Q3 Human
- SwissProt: Q9DCM2 Mouse
- Unigene: 390667 Human
- Unigene: 267014 Mouse
-
Alternative names
- EC 2.5.1.18 antibody
- Glutathione S Transferase kappa 1 antibody
- Glutathione S transferase subunit 13 antibody
see all
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-GSTK1 antibody (ab231549)
Paraffin-embedded mouse liver tissue stained for GSTK1 using ab231549 at 20 µg/ml in immunohistochemical analysis. DAB staining.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-GSTK1 antibody (ab231549)
Paraffin-embedded mouse kidney tissue stained for GSTK1 using ab231549 at 20 µg/ml in immunohistochemical analysis. DAB staining.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-GSTK1 antibody (ab231549)
Paraffin-embedded mouse brain tissue stained for GSTK1 using ab231549 at 20 µg/ml in immunohistochemical analysis. DAB staining.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-GSTK1 antibody (ab231549)
Paraffin-embedded mouse stomach tissue stained for GSTK1 using ab231549 at 20 µg/ml in immunohistochemical analysis. DAB staining.
-
All lanes : Anti-GSTK1 antibody (ab231549) at 3 µg/ml
Lane 1 : HeLa (human epithelial cell line from cervix adenocarcinoma) cell lysate
Lane 2 : Raji (human Burkitt's lymphoma cell line) cell lysate
Lane 3 : Mouse liver lysate
Lane 4 : Mouse heart lysate
Secondary
All lanes : HRP-Linked Guinea pig Anti-Rabbit at 1/2000 dilution
Predicted band size: 26 kDa -
Anti-GSTK1 antibody (ab231549) at 3 µg/ml + Recombinant human GSTK1 protein
Secondary
HRP-Linked Guinea pig Anti-Rabbit at 1/2000 dilution
Predicted band size: 26 kDa
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab231549 has not yet been referenced specifically in any publications.