Anti-GSTK1 antibody (ab231549)
- Datasheet
- References
- Protocols
Overview
-
Product name
Anti-GSTK1 antibody
See all GSTK1 primary antibodies -
Description
Rabbit polyclonal to GSTK1 -
Host species
Rabbit -
Tested applications
Suitable for: WB, IHC-Pmore details -
Species reactivity
Reacts with: Mouse, Human -
Immunogen
Recombinant fragment (His-T7-tag) corresponding to Mouse GSTK1 aa 19-222. N-terminal tags. Expressed in E.coli.
Sequence:SWLGFEVLCRYQHLWNIKLQLRPTLIAGIMKDSGNQPPAMVPRKGQYIFK EIPLLKQFFQVPLNIPKDFFGETVKKGSINAMRFLTTVSMEQPEMLEKVS REIWMRVWSRDEDITEYQSILAAAVKAGMSTAQAQHFLEKISTQQVKNKL IENTDAACKYGAFGLPTTVAHVDGKTYMLFGSDRLELLAYLLGEKWMGPV PPTA
Database link: Q9DCM2 -
Positive control
- IHC-P: Mouse liver, kidney, brain and stomach tissues. WB: HeLa and Raji cell lysates; Mouse liver and heart lysates; Recombinant human GSTK1 protein.
-
General notes
Previously labelled as Glutathione S Transferase kappa 1.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.40
Preservative: 0.02% Sodium azide
Constituents: PBS, 50% Glycerol -
Concentration information loading... -
Purity
Immunogen affinity purified -
Purification notes
ab231549 was purified by antigen-specific affinity chromatography followed by Protein A affinity chromatography. -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
-
Recombinant Protein
Applications
Our Abpromise guarantee covers the use of ab231549 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| WB | Use a concentration of 0.5 - 2 µg/ml. Predicted molecular weight: 26 kDa. | |
| IHC-P | Use a concentration of 5 - 20 µg/ml. |
Target
-
Function
Significant glutathione conjugating activity is found only with the model substrate, 1-chloro-2,4-dinitrobenzene (CDNB). -
Tissue specificity
Ubiquitous. -
Sequence similarities
Belongs to the GST superfamily. Kappa family. -
Cellular localization
Peroxisome. - Information by UniProt
-
Database links
- Entrez Gene: 373156 Human
- Entrez Gene: 76263 Mouse
- Omim: 602321 Human
- SwissProt: Q9Y2Q3 Human
- SwissProt: Q9DCM2 Mouse
- Unigene: 390667 Human
- Unigene: 267014 Mouse
-
Alternative names
- EC 2.5.1.18 antibody
- Glutathione S Transferase kappa 1 antibody
- Glutathione S transferase subunit 13 antibody
see all
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-GSTK1 antibody (ab231549)Paraffin-embedded mouse liver tissue stained for GSTK1 using ab231549 at 20 µg/ml in immunohistochemical analysis. DAB staining.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-GSTK1 antibody (ab231549)Paraffin-embedded mouse kidney tissue stained for GSTK1 using ab231549 at 20 µg/ml in immunohistochemical analysis. DAB staining.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-GSTK1 antibody (ab231549)Paraffin-embedded mouse brain tissue stained for GSTK1 using ab231549 at 20 µg/ml in immunohistochemical analysis. DAB staining.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-GSTK1 antibody (ab231549)Paraffin-embedded mouse stomach tissue stained for GSTK1 using ab231549 at 20 µg/ml in immunohistochemical analysis. DAB staining.
-
Western blot - Anti-GSTK1 antibody (ab231549)All lanes : Anti-GSTK1 antibody (ab231549) at 3 µg/ml
Lane 1 : HeLa (human epithelial cell line from cervix adenocarcinoma) cell lysate
Lane 2 : Raji (human Burkitt's lymphoma cell line) cell lysate
Lane 3 : Mouse liver lysate
Lane 4 : Mouse heart lysate
Secondary
All lanes : HRP-Linked Guinea pig Anti-Rabbit at 1/2000 dilution
Predicted band size: 26 kDa -
Western blot - Anti-GSTK1 antibody (ab231549)Anti-GSTK1 antibody (ab231549) at 3 µg/ml + Recombinant human GSTK1 protein
Secondary
HRP-Linked Guinea pig Anti-Rabbit at 1/2000 dilution
Predicted band size: 26 kDa
Datasheets and documents
References
ab231549 has not yet been referenced specifically in any publications.
