Overview

  • Product name

  • Description

    Rabbit polyclonal to GSTK1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Rat, Human
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Rat GSTK1 aa 20-214. Expressed in E.coli.
    Sequence:

    MGSSHHHHHHSSGLVPRGSHMASMTGGQQMGRGSEFWLGFEVLCRYQHLW NIKLKLRPALLAGIMKDSGNQPPAMVPHKGQYILKEIPLLKQLFQVPMSV PKDFFGEHVKKGTVNAMRFLTAVSMEQPEMLEKVSRELWMRIWSRDEDIT ESQNILSAAEKAGMATAQAQHLLNKISTELVKSKLRETTGAACKYGAFGL PTTVAHVDGKTYMLFGSDRMELLAYLLGEKW


    Database link: P24473

  • Positive control

    • WB: Recombinant rat GSTK1 protein; Raji cell lysate; rat liver lysate. IHC-P: Rat liver, stomach, pancreas and spinal cord tissue.
  • General notes

    Previously labelled as Glutathione S Transferase kappa 1. 

Properties

Applications

Our Abpromise guarantee covers the use of ab231593 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 25 kDa.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

  • Function

    Significant glutathione conjugating activity is found only with the model substrate, 1-chloro-2,4-dinitrobenzene (CDNB).
  • Tissue specificity

    Ubiquitous.
  • Sequence similarities

    Belongs to the GST superfamily. Kappa family.
  • Cellular localization

    Peroxisome.
  • Information by UniProt
  • Database links

  • Alternative names

    • EC 2.5.1.18 antibody
    • Glutathione S Transferase kappa 1 antibody
    • Glutathione S transferase subunit 13 antibody
    • Glutathione S-transferase k1 antibody
    • Glutathione S-transferase kappa 1 antibody
    • Glutathione S-transferase subunit 13 antibody
    • Glutathione S-transferase subunit 13 homolog antibody
    • GST 13 13 antibody
    • GST 13-13 antibody
    • GST antibody
    • GST class kappa antibody
    • GST class-kappa antibody
    • GST13 antibody
    • GST13-13 antibody
    • GSTK1 1 antibody
    • Gstk1 antibody
    • GSTK1-1 antibody
    • GSTK1_HUMAN antibody
    • hGSTK1 antibody
    see all

Images

  • Anti-GSTK1 antibody (ab231593) at 2 µg/ml + Recombinant rat GSTK1 protein

    Predicted band size: 25 kDa

  • Anti-GSTK1 antibody (ab231593) at 2 µg/ml + Raji (human Burkitt's lymphoma cell line) cell lysate

    Predicted band size: 25 kDa

  • Anti-GSTK1 antibody (ab231593) at 2 µg/ml + Rat liver lysate

    Predicted band size: 25 kDa

  • Formalin-fixed, paraffin-embedded rat liver tissue stained for GSTK1 using ab231593 at 20 µg/mL in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded rat stomach tissue stained for GSTK1 using ab231593 at 20 µg/mL in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded rat pancreas tissue stained for GSTK1 using ab231593 at 20 µg/mL in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded rat spinal cord tissue stained for GSTK1 using ab231593 at 20 µg/mL in immunohistochemical analysis. DAB staining.

References

ab231593 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231593.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up