Overview

  • Product name

  • Description

    Rabbit polyclonal to GSTM2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse, Human
    Predicted to work with: Rat, Cynomolgus monkey, Orangutan
  • Immunogen

    Recombinant full length protein corresponding to Human GSTM2 aa 1-218.
    Sequence:

    MPMTLGYWNIRGLAHSIRLLLEYTDSSYEEKKYTMGDAPDYDRSQWLNEK FKLGLDFPNLPYLIDGTHKITQSNAILRYIARKHNLCGESEKEQIREDIL ENQFMDSRMQLAKLCYDPDFEKLKPEYLQALPEMLKLYSQFLGKQPWFLG DKITFVDFIAYDVLERNQVFEPSCLDAFPNLKDFISRFEGLEKISAYMKS SRFLPRPVFTKMAVWGNK


    Database link: P28161

  • Positive control

    • Mouse testis and heart extracts, Human kidney tissue, HeLa cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab196503 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF 1/50 - 1/200.
IHC-P 1/50 - 1/100.
WB 1/500 - 1/2000. Predicted molecular weight: 26 kDa.

Target

Images

  • All lanes : Anti-GSTM2 antibody (ab196503) at 1/500 dilution

    Lane 1 : Mouse testis extract
    Lane 2 : Mouse heart extract

    Predicted band size: 26 kDa

  • Immunohistochemical analysis of paraffin-embedded Human kidney tissue labeling GSTM2 with ab196503 at 1/200 dilution (200x lens).

  • Immunofluorescent analysis of HeLa cells labeling GSTM2 with ab196503 at 1/50 dilution. Lower image shows DAPI for nuclear staining (Blue).

References

ab196503 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab196503.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up