Overview

  • Product name

  • Description

    Rabbit polyclonal to GSTM3
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse, Human
    Predicted to work with: Japanese macaque
  • Immunogen

    Recombinant full length protein corresponding to Human GSTM3 aa 1-225.
    Sequence:

    MSCESSMVLGYWDIRGLAHAIRLLLEFTDTSYEEKRYTCGEAPDYDRSQW LDVKFKLDLDFPNLPYLLDGKNKITQSNAILRYIARKHNMCGETEEEKIR VDIIENQVMDFRTQLIRLCYSSDHEKLKPQYLEELPGQLKQFSMFLGKFS WFAGEKLTFVDFLTYDILDQNRIFDPKCLDEFPNLKAFMCRFEALEKIAA YLQSDQFCKMPINNKMAQWGNKPVC


    Database link: P21266

  • Positive control

    • WB: Mouse kidney tissue lysate. IHC-P: Human testis tissue. ICC/IF: HeLa cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab229858 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF 1/50 - 1/200.
IHC-P 1/20 - 1/200.
WB 1/1000 - 1/5000. Predicted molecular weight: 27 kDa.

Target

  • Function

    Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles. May govern uptake and detoxification of both endogenous compounds and xenobiotics at the testis and brain blood barriers.
  • Tissue specificity

    Testis and brain.
  • Sequence similarities

    Belongs to the GST superfamily. Mu family.
    Contains 1 GST C-terminal domain.
    Contains 1 GST N-terminal domain.
  • Post-translational
    modifications

    The N-terminus is blocked.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt
  • Database links

  • Alternative names

    • brain GST antibody
    • brain type mu glutathione S transferase antibody
    • glutathione S alkyltransferase M3 antibody
    • glutathione S aryltransferase M3 antibody
    • glutathione S transferase M3 (brain) antibody
    • glutathione S transferase M3 antibody
    • Glutathione S transferase Mu 3 antibody
    • glutathione S transferase, Mu 3 antibody
    • Glutathione S-transferase Mu 3 antibody
    • GST class mu 3 antibody
    • GST class-mu 3 antibody
    • GST5 antibody
    • GSTB antibody
    • Gstm3 antibody
    • GSTM3-3 antibody
    • GSTM3_HUMAN antibody
    • GTM3 antibody
    • hGSTM3-3 antibody
    • MGC3310 antibody
    • MGC3704 antibody
    • S (hydroxyalkyl)glutathione lyase M3 antibody
    see all

Images

  • Anti-GSTM3 antibody (ab229858) at 1/1000 dilution + Mouse kidney tissue lysate

    Secondary
    Goat polyclonal to rabbit IgG at 1/50000 dilution

    Predicted band size: 27 kDa
    Observed band size: 27 kDa

  • Paraffin-embedded human testis tissue stained for GSTM3 using ab229858 at 1/100 dilution in immunohistochemical analysis.

  • HeLa (human epithelial cell line from cervix adenocarcinoma) cells stained for GSTM3 (green) using ab229858 at 1/100 dilution in ICC/IF, followed by Alexa Fluor®488-conjugated Goat anti-Rabbit IgG (H+L) as secondary antibody.

References

ab229858 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab229858.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up