Overview

  • Product name

  • Description

    Rabbit polyclonal to GSTM3
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Rabbit, Horse, Cow, Pig
  • Immunogen

    Synthetic peptide corresponding to Human GSTM3 aa 96-145 (internal sequence).
    Sequence:

    EEKIRVDIIENQVMDFRTQLIRLCYSSDHEKLKPQYLEELPGQLKQFSMF

  • Positive control

    • HepG2 whole cell lysate (ab7900) This antibody gave a positive result when used in the following methanol fixed cell line: HeLa.

Properties

Applications

Our Abpromise guarantee covers the use of ab74749 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 27 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.
ICC/IF Use a concentration of 5 µg/ml.

Target

  • Function

    Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles. May govern uptake and detoxification of both endogenous compounds and xenobiotics at the testis and brain blood barriers.
  • Tissue specificity

    Testis and brain.
  • Sequence similarities

    Belongs to the GST superfamily. Mu family.
    Contains 1 GST C-terminal domain.
    Contains 1 GST N-terminal domain.
  • Post-translational
    modifications

    The N-terminus is blocked.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt
  • Database links

  • Alternative names

    • brain GST antibody
    • brain type mu glutathione S transferase antibody
    • glutathione S alkyltransferase M3 antibody
    • glutathione S aryltransferase M3 antibody
    • glutathione S transferase M3 (brain) antibody
    • glutathione S transferase M3 antibody
    • Glutathione S transferase Mu 3 antibody
    • glutathione S transferase, Mu 3 antibody
    • Glutathione S-transferase Mu 3 antibody
    • GST class mu 3 antibody
    • GST class-mu 3 antibody
    • GST5 antibody
    • GSTB antibody
    • Gstm3 antibody
    • GSTM3-3 antibody
    • GSTM3_HUMAN antibody
    • GTM3 antibody
    • hGSTM3-3 antibody
    • MGC3310 antibody
    • MGC3704 antibody
    • S (hydroxyalkyl)glutathione lyase M3 antibody
    see all

Images

  • ICC/IF image of ab74749 stained HeLa cells.  The cells were 100% methanol fixed (5 min) and then incubated in 1%BSA / 10% normal goat serum/ 0.3M glycine in 0.1% PBS-Tween for 1h to permeabilise the cells and block non-specific protein-protein interactions. The cells were then incubated with the antibody ab74749 at 5 µg/mL overnight at +4°C. The secondary antibody (green) was DyLight® 488 Goat anti-Rabbit IgG (H+L) (ab96899) used at a 1/250 dilution for 1h. Alexa Fluor® 594 WGA was used to label plasma membranes (red) at a 1/200 dilution for 1h. DAPI was used to stain the cell nuclei (blue) at a concentration of 1.43µM.

  • Anti-GSTM3 antibody (ab74749) at 1 µg/ml (in 5% skim milk / PBS buffer) + HepG2 cell lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size: 27 kDa
    Observed band size: 27 kDa

References

This product has been referenced in:

  • Lin JH  et al. Oestrogen receptor-regulated glutathione S-transferase mu 3 expression attenuates hydrogen peroxide-induced cytotoxicity, which confers tamoxifen resistance on breast cancer cells. Breast Cancer Res Treat N/A:N/A (2018). Read more (PubMed: 30054830) »
  • Kocevar N  et al. Proteomic analysis of gastric cancer and immunoblot validation of potential biomarkers. World J Gastroenterol 18:1216-28 (2012). WB ; Human . Read more (PubMed: 22468085) »
See all 3 Publications for this product

Customer reviews and Q&As

1-3 of 3 Abreviews or Q&A

Answer

You have been using the product at a very low concentration (1/10,000). We recommend on our datasheet to use at a starting concentration of 1/1000, in this particular case you may find that you may need an even higher concentration and we recommend to titer the antibody in a range from 1/100-1/1000.

Read More

Answer

The short peptide sequence that was used to raise this antibody is 14aa in length, 100% homologous to this protein (http://www.uniprot.org/uniprot/P21266) and contained within this larger 50aa sequence: EEKIRVDIIENQVMDFRTQLIRLCYSSDHEKLKPQYLEELPGQLKQFSMF. I would like to offer some suggestions to help optimize the results from ab74749. I see you have used this product at 1/10,000 dlution. We recommend a starting dilution of 1/1000 when using this in western blot and to incubate the antibody overnight at +4C.

Read More
Application
Western blot
Sample
Human Tissue lysate - whole (stomach)
Loading amount
30 µg
Specification
stomach
Gel Running Conditions
Reduced Denaturing (12 %)
Blocking step
Milk as blocking agent for 16 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: 4°C

Abcam user community

Verified customer

Submitted Jul 11 2011

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up