Overview

  • Product name

  • Description

    Rabbit polyclonal to GSTM4
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Human
    Predicted to work with: Cynomolgus monkey
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Human GSTM4 aa 18-215. Expressed in E.coli.
    Sequence:

    RLLLEYTDSSYEEKKYTMGDAPDYDRSQWLNEKFKLGLDFPNLPYLIDGA HKITQSNAILCYIARKHNLCGETEEEKIRVDILENQAMDVSNQLARVCYS PDFEKLKPEYLEELPTMMQHFSQFLGKRPWFVGDKITFVDFLAYDVLDLH RIFEPNCLDAFPNLKDFISRFEGLEKISAYMKSSRFLPKPLYTRVAVW


    Database link: Q03013

  • Positive control

    • WB: Recombinant human GSTM4 protein; Human liver and lung lysates; Mouse liver and lung lysates. IHC-P: Human breast cancer, glioma, prostate, colorectal cancer, liver and stomach tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    Antigen-specific affinity chromatography followed by Protein A affinity chromatography.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab233281 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 26 kDa.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

  • Function

    Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles. Active on 1-chloro-2,4-dinitrobenzene.
  • Tissue specificity

    Expressed in a wide variety of tissues.
  • Sequence similarities

    Belongs to the GST superfamily. Mu family.
    Contains 1 GST C-terminal domain.
    Contains 1 GST N-terminal domain.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt
  • Database links

  • Alternative names

    • Glutathione S transferase M4 antibody
    • Glutathione S transferase Mu 4 antibody
    • Glutathione S-transferase Mu 4 antibody
    • GST class mu 4 antibody
    • GST class-mu 4 antibody
    • GST-Mu2 antibody
    • GSTM4 4 antibody
    • GSTM4 antibody
    • GSTM4-4 antibody
    • GSTM4_HUMAN antibody
    • GTM4 antibody
    • GTS Mu2 antibody
    • MGC131945 antibody
    • MGC9247 antibody
    see all

Images

  • Formalin-fixed, paraffin-embedded human colorectal cancer tissue stained for GSTM4 using ab233281 at 10 μg/ml in immunohistochemical analysis.

    Secondary used: HRP-Linked Goat Anti-Rabbit IgG Polyclonal at 2 µg/ml. DAB staining.

  • Anti-GSTM4 antibody (ab233281) at 2 µg/ml + Human liver lysate

    Secondary
    HRP-Linked Goat Anti-Rabbit IgG Polyclonal at 0.2 µg/ml

    Predicted band size: 26 kDa

  • Formalin-fixed, paraffin-embedded human breast cancer tissue stained for GSTM4 using ab233281 at 10 μg/ml in immunohistochemical analysis.

    Secondary used: HRP-Linked Goat Anti-Rabbit IgG Polyclonal at 2 µg/ml. DAB staining.

  • Formalin-fixed, paraffin-embedded human glioma tissue stained for GSTM4 using ab233281 at 10 μg/ml in immunohistochemical analysis.

    Secondary used: HRP-Linked Goat Anti-Rabbit IgG Polyclonal at 2 µg/ml. DAB staining.

  • Formalin-fixed, paraffin-embedded human prostate tissue stained for GSTM4 using ab233281 at 10 μg/ml in immunohistochemical analysis.

    Secondary used: HRP-Linked Goat Anti-Rabbit IgG Polyclonal at 2 µg/ml. DAB staining..

  • Formalin-fixed, paraffin-embedded human liver tissue stained for GSTM4 using ab233281 at 10 μg/ml in immunohistochemical analysis.

    Secondary used: HRP-Linked Goat Anti-Rabbit IgG Polyclonal at 2 µg/ml. DAB staining.

  • Formalin-fixed, paraffin-embedded human stomach tissue stained for GSTM4 using ab233281 at 10 μg/ml in immunohistochemical analysis.

    Secondary used: HRP-Linked Goat Anti-Rabbit IgG Polyclonal at 2 µg/ml. DAB staining.

  • Anti-GSTM4 antibody (ab233281) at 2 µg/ml + Human lung lysate

    Secondary
    HRP-Linked Goat Anti-Rabbit IgG Polyclonal at 0.2 µg/ml

    Predicted band size: 26 kDa

  • Anti-GSTM4 antibody (ab233281) at 2 µg/ml + Mouse liver lysate

    Secondary
    HRP-Linked Goat Anti-Rabbit IgG Polyclonal at 0.2 µg/ml

    Predicted band size: 26 kDa

  • Anti-GSTM4 antibody (ab233281) at 2 µg + Mouse lung lysate

    Secondary
    HRP-Linked Goat Anti-Rabbit IgG Polyclonal at 0.2 µg/ml

    Predicted band size: 26 kDa

  • Anti-GSTM4 antibody (ab233281) at 2 µg + Recombinant human GSTM4 protein

    Predicted band size: 26 kDa

References

ab233281 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab233281.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up