For the best experience on the Abcam website please upgrade to a modern browser such as Google Chrome

We use cookies to make our site as useful as possible.

Our Cookie Policy explains how you can opt-out of the cookies we use.

If you continue without changing your cookie settings, we'll assume you’re happy with this.

Continue Continue

United States
Your country/region is currently set to:

If incorrect, please enter your country/region into the box below, to view site information related to your country/region.

Call (888) 77-ABCAM (22226) or contact us
Need help? Contact us

  • My account
  • Sign out
Sign in or Register with us

Welcome

Sign in or

Don't have an account?

Register with us
My basket
Quick order
Abcam homepage

  • Research Products
    By product type
    Primary antibodies
    Secondary antibodies
    ELISA and Matched Antibody Pair Kits
    Cell and tissue imaging tools
    Cellular and biochemical assays
    Proteins and Peptides
    By product type
    Proteomics tools
    Agonists, activators, antagonists and inhibitors
    Cell lines and Lysates
    Multiplex miRNA assays
    Multiplex Assays
    By research area
    Cancer
    Cardiovascular
    Cell Biology
    Epigenetics
    Metabolism
    Developmental Biology
    By research area
    Immunology
    Microbiology
    Neuroscience
    Signal Transduction
    Stem Cells
  • Diagnostic & Therapeutic Solutions
    Custom solutions & partnerships

    Custom antibody development and commercial partnerships to advance your diagnostic and therapeutic discovery.

    Create custom solutions with us

    Partner with us

  • Support
    Support hub

    Access advice and support for any research roadblock

    View support hub

    Protocols

    Your experiments laid out step by step

    View protocols

  • Events
    • Conference calendar
    • Cancer
    • Cardiovascular
    • Epigenetics & Nuclear signaling
    • Immunology
    • Neuroscience
    • Stem cells
    • Tradeshows
    • Scientific webinars
    Keep up to date with the latest events

    Full event breakdown with abstracts, speakers, registration and more

    View global event calendar

  • Pathways
    Cell signalling pathways

    View all pathways

    View all interactive pathways

Supporting our customers and employees during the COVID-19 pandemic. Read more

  1. Link

    gstt1-antibody-ab175418.pdf

  1. Send me a copy of this email
    I agree to the terms and conditions.
Tags & Cell Markers Epitope Tags Conjugates
Share by email

Anti-GSTT1 antibody (ab175418)

  • Datasheet
  • SDS
Submit a review Q&A (1)References (1)

Product price, shipping and contact information

Currently unavailable

Sorry, we can't display this right now.

Please contact us to place your order, or try again later.

 

Loading size & price…

 

Shipping and order information

Abpromise

Guaranteed product quality, expert customer support.

Find out more.

Western blot - Anti-GSTT1 antibody (ab175418)

    Key features and details

    • Rabbit polyclonal to GSTT1
    • Suitable for: WB
    • Reacts with: Mouse, Rat, Human
    • Isotype: IgG

    You may also be interested in

    Secondary
    Product image
    Goat Anti-Rabbit IgG H&L (HRP) (ab205718)
    Protein
    Product image
    Recombinant Human GSTT1 protein (ab86849)

    View more associated products

    Overview

    • Product name

      Anti-GSTT1 antibody
      See all GSTT1 primary antibodies
    • Description

      Rabbit polyclonal to GSTT1
    • Host species

      Rabbit
    • Tested applications

      Suitable for: WBmore details
    • Species reactivity

      Reacts with: Mouse, Rat, Human
      Predicted to work with: Cow
    • Immunogen

      Recombinant full length protein corresponding to Human GSTT1 aa 1-240.
      Sequence:

      MGLELYLDLLSQPCRAVYIFAKKNDIPFELRIVDLIKGQHLSDAFAQVNP LKKVPALKDGDFTLTESVAILLYLTRKYKVPDYWYPQDLQARARVDEYLA WQHTTLRRSCLRALWHKVMFPVFLGEPVSPQTLAATLAELDVTLQLLEDK FLQNKAFLTGPHISLADLVAITELMHPVGAGCQVFEGRPKLATWRQRVEA AVGEDLFQEAHEVILKAKDFPPADPTIKQKLMPWVLAMIR


      Database link: P30711
      Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI
    • General notes

       This product was previously labelled as Glutathione S Transferase theta 1

       

      Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.

      Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.

      We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.

      In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.

      We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.

      Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.

      Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.

    Properties

    • Form

      Liquid
    • Storage instructions

      Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
    • Storage buffer

      pH: 7.30
      Preservative: 0.02% Sodium azide
      Constituents: 49% PBS, 50% Glycerol
    • Concentration information loading...
    • Purity

      Immunogen affinity purified
    • Clonality

      Polyclonal
    • Isotype

      IgG
    • Research areas

      • Tags & Cell Markers
      • Epitope Tags
      • Conjugates
      • Tags & Cell Markers
      • Fusion / Marker Proteins
      • GST

    Associated products

    • Compatible Secondaries

      • Goat Anti-Rabbit IgG H&L (Alexa Fluor® 488) (ab150077)
      • Goat Anti-Rabbit IgG H&L (HRP) (ab205718)
    • Isotype control

      • Rabbit IgG, polyclonal - Isotype Control (ChIP Grade) (ab171870)
    • Positive Controls

      • HepG2 whole cell lysate (ab166833)
    • Recombinant Protein

      • Recombinant Human GSTT1 protein (ab86849)

    Applications

    Our Abpromise guarantee covers the use of ab175418 in the following tested applications.

    The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

    Application Abreviews Notes
    WB 1/500 - 1/2000. Predicted molecular weight: 27 kDa.

    Target

    • Function

      Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles. Acts on 1,2-epoxy-3-(4-nitrophenoxy)propane, phenethylisothiocyanate 4-nitrobenzyl chloride and 4-nitrophenethyl bromide. Displays glutathione peroxidase activity with cumene hydroperoxide.
    • Tissue specificity

      Found in erythrocyte. Expressed at low levels in liver. In lung, expressed at low levels in Clara cells and ciliated cells at the alveolar/bronchiolar junction. Absent from epithelial cells of larger bronchioles.
    • Sequence similarities

      Belongs to the GST superfamily. Theta family.
      Contains 1 GST C-terminal domain.
      Contains 1 GST N-terminal domain.
    • Cellular localization

      Cytoplasm.
    • Target information above from: UniProt accession P30711 The UniProt Consortium
      The Universal Protein Resource (UniProt) in 2010
      Nucleic Acids Res. 38:D142-D148 (2010) .

      Information by UniProt
    • Database links

      • Entrez Gene: 2952 Human
      • Entrez Gene: 14871 Mouse
      • Entrez Gene: 25260 Rat
      • Omim: 600436 Human
      • SwissProt: P30711 Human
      • SwissProt: Q64471 Mouse
      • SwissProt: Q01579 Rat
      • Unigene: 268573 Human
      • Unigene: 720100 Human
      • Unigene: 2746 Mouse
      • Unigene: 11122 Rat
      see all
    • Alternative names

      • EC 2.5.1.18 antibody
      • Glutathione S transferase 5 antibody
      • Glutathione S transferase theta 1 antibody
      • Glutathione S-transferase theta-1 antibody
      • Glutathione transferase T1 1 antibody
      • Glutathione transferase T1-1 antibody
      • GST 5 5 antibody
      • GST CL1 antibody
      • GST class theta 1 antibody
      • GST class-theta-1 antibody
      • GSTT1 antibody
      • GSTT1_HUMAN antibody
      see all

    Images

    • Western blot - Anti-GSTT1 antibody (ab175418)
      Western blot - Anti-GSTT1 antibody (ab175418)
      Anti-GSTT1 antibody (ab175418) at 1/500 dilution + HepG2 cell extract

      Predicted band size: 27 kDa

    Protocols

    • Western blot protocols

    Click here to view the general protocols

    Datasheets and documents

    • Datasheet
    • SDS
  • References (1)

    Publishing research using ab175418? Please let us know so that we can cite the reference in this datasheet.

    ab175418 has been referenced in 1 publication.

    • Xie MY  et al. 5-aza-2'-deoxycytidine in the regulation of antioxidant enzymes in retinal endothelial cells and rat diabetic retina. Int J Ophthalmol 12:1-7 (2019). PubMed: 30662833

    Customer reviews and Q&As

    Show All Reviews Q&A
    Submit a review Submit a question

    Question

    Hello! I am looking to buy a human GSTT1 primary antibody for western blotting. I wish to avoid cross-reactivity with GSTT2 and am looking for an antibody that preferably binds to the C-terminus.

    Read More

    Abcam community

    Verified customer

    Asked on Oct 30 2013

    Answer

    The Anti-Glutathione S Transferase theta 1 antibody (ab81033) has not been tested for cross-reactivity with the GSTT2 protein. The short immunogen peptide (˜14 aa) used to raise this antibody has 100% homology to human GSTT1 protein. The immunogen peptide has no homology/ similarity to the human GSTT2 protein, therefore it is safe to say that it will not be cross-reactive.

    Unfortunately, the Anti-Glutathione S Transferase theta 1 antibody (ab96592) has not been tested in any cross-reactivity experiment to determine the specificity of the antibody for GSTT1. The homology identity of the ab96592 immunogen to GSTT2 is 54%. Therefore there is a chance that the antibody would react with GSTT2.

    Unfortunately, the Anti-Glutathione S Transferase theta 1 (ab175418) antibody has not been tested in any cross-reactivity experiment to determine the specificity of the antibody for GSTT1. The molecular weight of these two protein are closed therefore the two proteins cannot be distinguished through WB experiment.

    Read More

    Abcam Scientific Support

    Answered on Oct 30 2013

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com

    Get resources and offers direct to your inbox Sign up
    A-Z by research area
    • Cancer
    • Cardiovascular
    • Cell biology
    • Developmental biology
    • Epigenetics & Nuclear signaling
    • Immunology
    • Metabolism
    • Microbiology
    • Neuroscience
    • Signal transduction
    • Stem cells
    A-Z by product type
    • Primary antibodies
    • Secondary antibodies
    • Biochemicals
    • Isotype controls
    • Flow cytometry multi-color selector
    • Kits
    • Loading controls
    • Lysates
    • Peptides
    • Proteins
    • Slides
    • Tags and cell markers
    • Tools & Reagents
    Help & support
    • Support
    • Make an Inquiry
    • Protocols & troubleshooting
    • Placing an order
    • RabMAb products
    • Biochemical product FAQs
    • Training
    • Browse by Target
    Company
    • Corporate site
    • Investor relations
    • Company news
    • Careers
    • About us
    • Blog
    Events
    • Tradeshows
    • Conferences
    International websites
    • abcam.cn
    • abcam.co.jp

    Join with us

    • LinkedIn
    • facebook
    • Twitter
    • YouTube
    • Terms of sale
    • Website terms of use
    • Cookie policy
    • Privacy policy
    • Legal
    • Modern slavery statement
    © 1998-2021 Abcam plc. All rights reserved.