Anti-GSTT1 antibody (ab175418)

Submit a review Q&A (1)References (1)
Western blot - Anti-GSTT1 antibody (ab175418)

    Key features and details

    • Rabbit polyclonal to GSTT1
    • Suitable for: WB
    • Reacts with: Mouse, Rat, Human
    • Isotype: IgG

    Overview

    • Product name

      Anti-GSTT1 antibody
      See all GSTT1 primary antibodies

    • Description

      Rabbit polyclonal to GSTT1

    • Host species

      Rabbit

    • Tested applications

      Suitable for: WBmore details

    • Species reactivity

      Reacts with: Mouse, Rat, Human
      Predicted to work with: Cow

    • Immunogen

      Recombinant full length protein corresponding to Human GSTT1 aa 1-240.
      Sequence:

      MGLELYLDLLSQPCRAVYIFAKKNDIPFELRIVDLIKGQHLSDAFAQVNP LKKVPALKDGDFTLTESVAILLYLTRKYKVPDYWYPQDLQARARVDEYLA WQHTTLRRSCLRALWHKVMFPVFLGEPVSPQTLAATLAELDVTLQLLEDK FLQNKAFLTGPHISLADLVAITELMHPVGAGCQVFEGRPKLATWRQRVEA AVGEDLFQEAHEVILKAKDFPPADPTIKQKLMPWVLAMIR


      Database link: P30711
      Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI

    • General notes

       This product was previously labelled as Glutathione S Transferase theta 1

       

      Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.

      Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.

      We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.

      In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.

      We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.

      Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.

      Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.

    Properties

    • Form

      Liquid

    • Storage instructions

      Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.

    • Storage buffer

      pH: 7.30
      Preservative: 0.02% Sodium azide
      Constituents: 49% PBS, 50% Glycerol
    • Concentration information loading...

    • Purity

      Immunogen affinity purified

    • Clonality

      Polyclonal

    • Isotype

      IgG

    • Research areas

    Applications

    Our Abpromise guarantee covers the use of ab175418 in the following tested applications.

    The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

    Application Abreviews Notes
    WB 1/500 - 1/2000. Predicted molecular weight: 27 kDa.

    Target

    • Function

      Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles. Acts on 1,2-epoxy-3-(4-nitrophenoxy)propane, phenethylisothiocyanate 4-nitrobenzyl chloride and 4-nitrophenethyl bromide. Displays glutathione peroxidase activity with cumene hydroperoxide.

    • Tissue specificity

      Found in erythrocyte. Expressed at low levels in liver. In lung, expressed at low levels in Clara cells and ciliated cells at the alveolar/bronchiolar junction. Absent from epithelial cells of larger bronchioles.

    • Sequence similarities

      Belongs to the GST superfamily. Theta family.
      Contains 1 GST C-terminal domain.
      Contains 1 GST N-terminal domain.

    • Cellular localization

      Cytoplasm.
    • Information by UniProt

    • Database links

      see all

    • Alternative names

      • EC 2.5.1.18 antibody
      • Glutathione S transferase 5 antibody
      • Glutathione S transferase theta 1 antibody
      • Glutathione S-transferase theta-1 antibody
      • Glutathione transferase T1 1 antibody
      • Glutathione transferase T1-1 antibody
      • GST 5 5 antibody
      • GST CL1 antibody
      • GST class theta 1 antibody
      • GST class-theta-1 antibody
      • GSTT1 antibody
      • GSTT1_HUMAN antibody
      see all

    Images

    • Western blot - Anti-GSTT1 antibody (ab175418)
      Western blot - Anti-GSTT1 antibody (ab175418)
      Anti-GSTT1 antibody (ab175418) at 1/500 dilution + HepG2 cell extract

      Predicted band size: 27 kDa

    References (1)

    Publishing research using ab175418? Please let us know so that we can cite the reference in this datasheet.

    ab175418 has been referenced in 1 publication.

    • Xie MY  et al. 5-aza-2'-deoxycytidine in the regulation of antioxidant enzymes in retinal endothelial cells and rat diabetic retina. Int J Ophthalmol 12:1-7 (2019). PubMed: 30662833

    Customer reviews and Q&As

    Show All Reviews Q&A
    Submit a review Submit a question

    Question

    Hello! I am looking to buy a human GSTT1 primary antibody for western blotting. I wish to avoid cross-reactivity with GSTT2 and am looking for an antibody that preferably binds to the C-terminus.

    Read More
    Answer

    The Anti-Glutathione S Transferase theta 1 antibody (ab81033) has not been tested for cross-reactivity with the GSTT2 protein. The short immunogen peptide (˜14 aa) used to raise this antibody has 100% homology to human GSTT1 protein. The immunogen peptide has no homology/ similarity to the human GSTT2 protein, therefore it is safe to say that it will not be cross-reactive.

    Unfortunately, the Anti-Glutathione S Transferase theta 1 antibody (ab96592) has not been tested in any cross-reactivity experiment to determine the specificity of the antibody for GSTT1. The homology identity of the ab96592 immunogen to GSTT2 is 54%. Therefore there is a chance that the antibody would react with GSTT2.

    Unfortunately, the Anti-Glutathione S Transferase theta 1 (ab175418) antibody has not been tested in any cross-reactivity experiment to determine the specificity of the antibody for GSTT1. The molecular weight of these two protein are closed therefore the two proteins cannot be distinguished through WB experiment.

    Read More

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com