Anti-GSTT1 antibody (ab175418)
Key features and details
- Rabbit polyclonal to GSTT1
- Suitable for: WB
- Reacts with: Mouse, Rat, Human
- Isotype: IgG
Overview
-
Product name
Anti-GSTT1 antibody
See all GSTT1 primary antibodies -
Description
Rabbit polyclonal to GSTT1 -
Host species
Rabbit -
Tested applications
Suitable for: WBmore details -
Species reactivity
Reacts with: Mouse, Rat, Human
Predicted to work with: Cow -
Immunogen
Recombinant full length protein corresponding to Human GSTT1 aa 1-240.
Sequence:MGLELYLDLLSQPCRAVYIFAKKNDIPFELRIVDLIKGQHLSDAFAQVNP LKKVPALKDGDFTLTESVAILLYLTRKYKVPDYWYPQDLQARARVDEYLA WQHTTLRRSCLRALWHKVMFPVFLGEPVSPQTLAATLAELDVTLQLLEDK FLQNKAFLTGPHISLADLVAITELMHPVGAGCQVFEGRPKLATWRQRVEA AVGEDLFQEAHEVILKAKDFPPADPTIKQKLMPWVLAMIR
Database link: P30711 -
General notes
This product was previously labelled as Glutathione S Transferase theta 1
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.30
Preservative: 0.02% Sodium azide
Constituents: 49% PBS, 50% Glycerol -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
-
Recombinant Protein
Applications
Our Abpromise guarantee covers the use of ab175418 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB | 1/500 - 1/2000. Predicted molecular weight: 27 kDa. |
Target
-
Function
Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles. Acts on 1,2-epoxy-3-(4-nitrophenoxy)propane, phenethylisothiocyanate 4-nitrobenzyl chloride and 4-nitrophenethyl bromide. Displays glutathione peroxidase activity with cumene hydroperoxide. -
Tissue specificity
Found in erythrocyte. Expressed at low levels in liver. In lung, expressed at low levels in Clara cells and ciliated cells at the alveolar/bronchiolar junction. Absent from epithelial cells of larger bronchioles. -
Sequence similarities
Belongs to the GST superfamily. Theta family.
Contains 1 GST C-terminal domain.
Contains 1 GST N-terminal domain. -
Cellular localization
Cytoplasm. - Information by UniProt
-
Database links
- Entrez Gene: 2952 Human
- Entrez Gene: 14871 Mouse
- Entrez Gene: 25260 Rat
- Omim: 600436 Human
- SwissProt: P30711 Human
- SwissProt: Q64471 Mouse
- SwissProt: Q01579 Rat
- Unigene: 268573 Human
see all -
Alternative names
- EC 2.5.1.18 antibody
- Glutathione S transferase 5 antibody
- Glutathione S transferase theta 1 antibody
see all
Images
References (1)
ab175418 has been referenced in 1 publication.
- Xie MY et al. 5-aza-2'-deoxycytidine in the regulation of antioxidant enzymes in retinal endothelial cells and rat diabetic retina. Int J Ophthalmol 12:1-7 (2019). PubMed: 30662833