Overview

  • Product name

  • Description

    Rabbit polyclonal to GSTT2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Human GSTT2 aa 15-235. N-terminal tags. Expressed in E.coli.
    Sequence:

    MGSSHHHHHHSSGLVPRGSHMASMTGGQQMGRGSEF-RAVYIFAKKNGIP LELRTVDLVKGQHKSKEFLQINSLGKLPTLKDGDFILTESSAILIYLSCK YQTPDHWYPSDLQARARVHEYLGWHADCIRGTFGIPLWVQVLGPLIGVQV PKEKVERNRTAMDQALQWLEDKFLGDRPFLAGQQVTLADLMALEELMQPV ALGYELFEGRPRLAAWRGRVEAFLGAELCQEAHSIILSILEQAAKKTLPT PSPEAYQA


    Database link: P0CG30

  • Positive control

    • IHC-P: Human glioma, kidney and liver tissues. WB: Recombinant human GSTT2 protein; Mouse lung and rat kidney lysates.
  • General notes

     This product was previously labelled as Glutathione S Transferase theta 2

     

Properties

Applications

Our Abpromise guarantee covers the use of ab231792 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 - 20 µg/ml.
WB Use a concentration of 0.2 - 2 µg/ml.

Target

  • Function

    Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles. Has a sulfatase activity.
  • Tissue specificity

    Expressed at low levels in liver. In lung, expressed at low levels in ciliated bronchiolar cells, alveolar macrophages and alveolar type II cells.
  • Sequence similarities

    Belongs to the GST superfamily. Theta family.
    Contains 1 GST C-terminal domain.
    Contains 1 GST N-terminal domain.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt
  • Database links

  • Alternative names

    • AI266894 antibody
    • EC 2.5.1.18 antibody
    • Glutathione S transferase 12 antibody
    • Glutathione S transferase Yrs Yrs antibody
    • Glutathione S-transferase theta-2 antibody
    • Glutathione S-transferase theta-2B antibody
    • GST 12 12 antibody
    • GST class theta 2 antibody
    • GST class-theta-2 antibody
    • GST T2 antibody
    • GSTT 2 antibody
    • GSTT2 antibody
    • GSTT2 protein antibody
    • GSTT2_HUMAN antibody
    • GSTT2B antibody
    • GSTT2P antibody
    • MGC182032 antibody
    • mGSTT2 antibody
    • OTTHUMP00000198491 antibody
    • OTTHUMP00000198492 antibody
    • Yrs antibody
    see all

Images

  • Formalin-fixed, paraffin-embedded human liver tissue stained for GSTT2 using ab231792 at 20 µg/mL in immunohistochemical analysis. DAB staining.

  • Anti-GSTT2 antibody (ab231792) at 1 µg/ml + Rat kidney lysate.

    Developed using the ECL technique.
  • Anti-GSTT2 antibody (ab231792) at 2 µg/ml + Mouse lung lysate

    Developed using the ECL technique.
  • Formalin-fixed, paraffin-embedded human kidney tissue stained for GSTT2 using ab231792 at 20 µg/mL in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded human glioma tissue stained for GSTT2 using ab231792 at 10 µg/mL in immunohistochemical analysis. DAB staining.

  • Anti-GSTT2 antibody (ab231792) at 2 µg/ml + Recombinant human GSTT2 protein

    Developed using the ECL technique.

References

ab231792 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231792.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up