Overview

  • Product name

  • Description

    Rabbit polyclonal to GSTT2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse, Rat
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Rat GSTT2 aa 16-242. Expressed in E.coli. N-terminal tags.
    Sequence:

    AVYIFAKKNGIPFQLRTVDLLKGQHLSEQFSQVNCLKKVPVLKDGSFVLT ESTAILIYLSSKYQVADHWYPADLQARAQVHEYLGWHADNIRGTFGVLLW TKVLGPLIGVQVPEEKVERNRNSMVLALQRLEDKFLRDRAFIAGQQVTLA DLMSLEELIQPVALGCNLFEGRPQLTAWRERVEAFLGAELCQEAHNPIMS VLGQAAKKTLPVPPPEAHASMMLRIAR


    Database link: P30713

  • Positive control

    • WB: Recombinant rat GSTT2 protein; Rat lung, kidney and pancreas lysates; Mouse lung lysate. IHC-P: Rat liver, spinal cord, adrenal gland, pancreas and lung tissue.
  • General notes

     This product was previously labelled as Glutathione S Transferase theta 2

     

Properties

Applications

Our Abpromise guarantee covers the use of ab232795 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 - 20 µg/ml.
WB Use a concentration of 0.5 - 5 µg/ml. Predicted molecular weight: 27 kDa.

Target

  • Function

    Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles. Has a sulfatase activity.
  • Tissue specificity

    Expressed at low levels in liver. In lung, expressed at low levels in ciliated bronchiolar cells, alveolar macrophages and alveolar type II cells.
  • Sequence similarities

    Belongs to the GST superfamily. Theta family.
    Contains 1 GST C-terminal domain.
    Contains 1 GST N-terminal domain.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt
  • Database links

  • Alternative names

    • AI266894 antibody
    • EC 2.5.1.18 antibody
    • Glutathione S transferase 12 antibody
    • Glutathione S transferase Yrs Yrs antibody
    • Glutathione S-transferase theta-2 antibody
    • Glutathione S-transferase theta-2B antibody
    • GST 12 12 antibody
    • GST class theta 2 antibody
    • GST class-theta-2 antibody
    • GST T2 antibody
    • GSTT 2 antibody
    • GSTT2 antibody
    • GSTT2 protein antibody
    • GSTT2_HUMAN antibody
    • GSTT2B antibody
    • GSTT2P antibody
    • MGC182032 antibody
    • mGSTT2 antibody
    • OTTHUMP00000198491 antibody
    • OTTHUMP00000198492 antibody
    • Yrs antibody
    see all

Images

  • All lanes : Anti-GSTT2 antibody (ab232795) at 3 µg

    Lane 1 : Rat kidney lysate
    Lane 2 : Rat lung lysate
    Lane 3 : Rat pancreas lysate
    Lane 4 : Mouse lung lysate

    Secondary
    All lanes : HRP-Linked Guinea pig anti-Rabbit at 1/2000 dilution

    Predicted band size: 27 kDa

  • Formalin-fixed, paraffin-embedded rat liver tissue stained for GSTT2 using ab232795 at 10 μg/ml in immunohistochemical analysis.

    Secondary used: HRP-Linked Goat anti-Rabbit IgG polyclonal at 2 µg/ml. DAB staining.

  • Formalin-fixed, paraffin-embedded rat spinal cord tissue stained for GSTT2 using ab232795 at 10 μg/ml in immunohistochemical analysis.

    Secondary used: HRP-Linked Goat anti-Rabbit IgG polyclonal at 2 µg/ml. DAB staining.

  • Formalin-fixed, paraffin-embedded rat adrenal gland tissue stained for GSTT2 using ab232795 at 10 μg/ml in immunohistochemical analysis.

    Secondary used: HRP-Linked Goat anti-Rabbit IgG polyclonal at 2 µg/ml. DAB staining.

  • Formalin-fixed, paraffin-embedded rat pancreas tissue stained for GSTT2 using ab232795 at 10 μg/ml in immunohistochemical analysis.

    Secondary used: HRP-Linked Goat anti-Rabbit IgG polyclonal at 2 µg/ml. DAB staining.

  • Formalin-fixed, paraffin-embedded rat lung tissue stained for GSTT2 using ab232795 at 10 μg/ml in immunohistochemical analysis.

    Secondary used: HRP-Linked Goat anti-Rabbit IgG polyclonal at 2 µg/ml. DAB staining.

  • Anti-GSTT2 antibody (ab232795) at 3 µg/ml + Recombinant rat GSTT2 protein

    Secondary
    HRP-Linked Guinea pig anti-Rabbit at 1/2000 dilution

    Predicted band size: 27 kDa

References

ab232795 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab232795.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up