Overview

  • Product name

  • Description

    Rabbit polyclonal to GTF2A2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Recombinant full length protein corresponding to Human GTF2A2 aa 1-109.
    Sequence:

    MAYQLYRNTTLGNSLQESLDELIQSQQITPQLALQVLLQFDKAINAALAQ RVRNRVNFRGSLNTYRFCDNVWTFVLNDVEFREVTELIKVDKVKIVACDG KNTGSNTTE


    Database link: P52657

  • Positive control

    • IHC-P: Human prostate cancer and liver cancer tissues.

Properties

Applications

Our Abpromise guarantee covers the use of ab229882 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.

Target

  • Function

    TFIIA is a component of the transcription machinery of RNA polymerase II and plays an important role in transcriptional activation. TFIIA in a complex with TBP mediates transcriptional activity.
  • Sequence similarities

    Belongs to the TFIIA subunit 2 family.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • General transcription factor IIA antibody
    • General transcription factor IIA subunit 2 antibody
    • General transcription factor IIA, 2 (12kD subunit) antibody
    • General transcription factor IIA, 2, 12kDa antibody
    • gtf2a2 antibody
    • HsT18745 antibody
    • T2AG_HUMAN antibody
    • TF2A2 antibody
    • TFIIA 12 antibody
    • TFIIA antibody
    • TFIIA gamma antibody
    • TFIIA p12 subunit antibody
    • TFIIA-12 antibody
    • TFIIA-gamma antibody
    • TFIIA12 antibody
    • TFIIAS antibody
    • Transcription initiation factor IIA gamma chain antibody
    • Transcription initiation factor IIA subunit 2 antibody
    see all

Images

  • Paraffin-embedded human prostate cancer tissue stained for GTF2A2 using ab229882 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human liver cancer tissue stained for GTF2A2 using ab229882 at 1/100 dilution in immunohistochemical analysis.

References

ab229882 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab229882.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up