Overview

  • Product name

  • Description

    Rabbit polyclonal to GTF2F1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
    Predicted to work with: Cow
  • Immunogen

    Recombinant full length protein corresponding to Human GTF2F1 aa 1-517.
    Sequence:

    MAALGPSSQNVTEYVVRVPKNTTKKYNIMAFNAADKVNFATWNQARLERD LSNKKIYQEEE MPESGAGSEFNRKLREEARRKKYGIVLKEFRPEDQPW LLRVNGKSGRKFKGIKKGGVTEN TSYYIFTQCPDGAFEAFPVHNWYNF TPLARHRTLTAEEAEEEWERRNKVLNHFSIMQQRR LKDQDQDEDEEEK EKRGRRKASELRIHDLEDDLEMSSDASDASGEEGGRVPKAKKKAPLA K GGRKKKKKKGSDDEAFEDSDDGDFEGQEVDYMSDGSSSSQEEPESKAKAP QQEEGPKGV DEQSDSSEESEEEKPPEEDKEEEEEKKAPTPQEKKRRKD SSEESDSSEESDIDSEASSAL FMAKKKTPPKRERKPSGGSSRGNSRPG TPSAEGGSTSSTLRAAASKLEQGKRVSEMPAAK RLRLDTGPQSLSGKS TPQPPSGKTTPNSGDVQVTEDAVRRYLTRKPMTTKDLLKKFQTKK TGL SSEQTVNVLAQILKRLNPERKMINDKMHFSLKE


    Database link: P35269

Properties

Applications

Our Abpromise guarantee covers the use of ab192479 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use at an assay dependent concentration. Predicted molecular weight: 58 kDa.
IHC-P Use at an assay dependent concentration.

Target

  • Function

    TFIIF is a general transcription initiation factor that binds to RNA polymerase II and helps to recruit it to the initiation complex in collaboration with TFIIB. It promotes transcription elongation.
  • Sequence similarities

    Belongs to the TFIIF alpha subunit family.
  • Post-translational
    modifications

    Phosphorylated on Ser and other residues by TAF1 and casein kinase II-like kinases.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • 2810405L04Rik antibody
    • BTF4 antibody
    • C76800 antibody
    • General transcription factor IIF 74 kDa subunit antibody
    • General transcription factor IIF subunit 1 antibody
    • General transcription factor IIF, polypeptide 1, 74kDa antibody
    • Gtf2f1 antibody
    • MGC94148 antibody
    • OTTHUMP00000237859 antibody
    • RAP74 antibody
    • T2FA_HUMAN antibody
    • TF2F1 antibody
    • TFIIF antibody
    • TFIIF-alpha antibody
    • Transcription initiation factor IIF subunit alpha antibody
    • Transcription initiation factor RAP74 antibody
    see all

References

ab192479 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab192479.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up