Overview

  • Product name

  • Description

    Rabbit polyclonal to GTF2F1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Cow
  • Immunogen

    Recombinant fragment corresponding to Human GTF2F1 aa 269-412.
    Sequence:

    QEVDYMSDGSSSSQEEPESKAKAPQQEEGPKGVDEQSDSSEESEEEKPPE EDKEEEEEKKAPTPQEKKRRKDSSEESDSSEESDIDSEASSALFMAKKKT PPKRERKPSGGSSRGNSRPGTPSAEGGSTSSTLRAAASKLEQGK


    Database link: P35269

  • Positive control

    • MCF7 cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab220066 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

Target

  • Function

    TFIIF is a general transcription initiation factor that binds to RNA polymerase II and helps to recruit it to the initiation complex in collaboration with TFIIB. It promotes transcription elongation.
  • Sequence similarities

    Belongs to the TFIIF alpha subunit family.
  • Post-translational
    modifications

    Phosphorylated on Ser and other residues by TAF1 and casein kinase II-like kinases.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • 2810405L04Rik antibody
    • BTF4 antibody
    • C76800 antibody
    • General transcription factor IIF 74 kDa subunit antibody
    • General transcription factor IIF subunit 1 antibody
    • General transcription factor IIF, polypeptide 1, 74kDa antibody
    • Gtf2f1 antibody
    • MGC94148 antibody
    • OTTHUMP00000237859 antibody
    • RAP74 antibody
    • T2FA_HUMAN antibody
    • TF2F1 antibody
    • TFIIF antibody
    • TFIIF-alpha antibody
    • Transcription initiation factor IIF subunit alpha antibody
    • Transcription initiation factor RAP74 antibody
    see all

Images

  • Immunofluorescent analysis of PFA-fixed, Triton X-100 permeabilized MCF7 cells labeling GTF2F1 with ab220066 at 4 μg/ml (green).

References

ab220066 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab220066.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up