Overview

  • Product name

  • Description

    Rabbit polyclonal to GTF2H1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human, Pig
    Predicted to work with: Mouse
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Human GTF2H1 aa 84-335. N-terminal tags. Expressed in E. coli.
    Sequence:

    MGSSHHHHHHSSGLVPRGSHMASMTGGQQMGRGS-TAVKERDAVKDLLQQ LLPKFKRKANKELEEKNRMLQEDPVLFQLYKDLVVSQVISAEEFWANRLN VNATDSSSTSNHKQDVGISAAFLADVRPQTDGCNGLRYNLTSDIIESIFR TYPAVKMKYAENVPHNMTEKEFWTRFFQSHYFHRDRLNTGSKDLFAECAK IDEKGLKTMVSLGVKNPLLDLTALEDKPLDEGYGISSVPSASNSKSIKEN SNAAIIKRFNHHSAMVLAAGLRKQEAQNEQTSEPSNM


    Database link: P32780

  • Positive control

    • IHC-P: Human liver tissue. WB: Pig cerebrum and liver tissue lysate. HepG2 cell lysate. Recombinant human GTF2H1 protein.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Protein A purified
  • Purification notes

    Antigen-specific affinity chromatography followed by Protein A affinity chromatography
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab232982 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 62 kDa.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

  • Function

    Component of the core-TFIIH basal transcription factor involved in nucleotide excision repair (NER) of DNA and, when complexed to CAK, in RNA transcription by RNA polymerase II.
  • Sequence similarities

    Contains 2 BSD domains.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • Basic transcription factor 2 62 kDa subunit antibody
    • Basic transcription factor 62 kDa subunit antibody
    • BTF 2 antibody
    • BTF2 antibody
    • BTF2 p62 antibody
    • General transcription factor IIH polypeptide 1 antibody
    • General transcription factor IIH subunit 1 antibody
    • General transcription factor IIH, polypeptide 1, 62kDa antibody
    • gtf2h1 antibody
    • TF2H1 antibody
    • TF2H1_HUMAN antibody
    • TFB1 antibody
    • TFIIH antibody
    • TFIIH basal transcription factor complex p62 subunit antibody
    see all

Images

  • Formalin-fixed, paraffin-embedded human liver tissue stained for GTF2H1 with ab232982 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Anti-GTF2H1 antibody (ab232982) at 5 µg/ml + Pig cerebrum tissue lysate

    Secondary
    HRP-Linked Goat anti-Rabbit IgG polyclonal at 0.2 µg/ml

    Predicted band size: 62 kDa

  • Anti-GTF2H1 antibody (ab232982) at 5 µg/ml + HepG2 (Human liver hepatocellular carcinoma cell line) cell lysate

    Secondary
    HRP-Linked Goat anti-Rabbit IgG polyclonal at 0.2 µg/ml

    Predicted band size: 62 kDa

  • Anti-GTF2H1 antibody (ab232982) at 5 µg/ml + Pig liver tissue lysate

    Secondary
    HRP-Linked Goat anti-Rabbit IgG polyclonal at 0.2 µg/ml

    Predicted band size: 62 kDa

  • Anti-GTF2H1 antibody (ab232982) at 2 µg/ml + Recombinant human GTF2H1 protein

    Predicted band size: 62 kDa

References

ab232982 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab232982.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up