Overview

  • Product name

  • Description

    Rabbit polyclonal to GTF2H4
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Chimpanzee
  • Immunogen

    Recombinant fragment corresponding to Human GTF2H4 aa 78-160.
    Sequence:

    EFSKAQEESTGLLSGLRIWHTQLLPGGLQGLILNPIFRQNLRIALLGGGK AWSDDTSQLGPDKHARDVPSLDKYAEERWEVVL


    Database link: Q92759

  • Positive control

    • ICC/IF: U-2 OS cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab221999 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

Target

  • Function

    Component of the core-TFIIH basal transcription factor involved in nucleotide excision repair (NER) of DNA and, when complexed to CAK, in RNA transcription by RNA polymerase II.
  • Sequence similarities

    Belongs to the TFB2 family.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • Basic transcription factor 2 52 kDa subunit antibody
    • Basic transcription factor 52 kDa subunit antibody
    • BTF2 p52 antibody
    • General transcription factor IIH polypeptide 4 52kDa antibody
    • General transcription factor IIH polypeptide 4 52kDa subunit antibody
    • General transcription factor IIH polypeptide 4 52kDa variant antibody
    • General transcription factor IIH polypeptide 4 antibody
    • General transcription factor IIH subunit 4 antibody
    • Gtf2h4 antibody
    • OTTHUMP00000029049 antibody
    • OTTHUMP00000164874 antibody
    • P52 antibody
    • TF2H4_HUMAN antibody
    • TFB2 antibody
    • TFIIH basal transcription factor complex p52 subunit antibody
    • TFIIH protein antibody
    • TIFIIH antibody
    • Transcription factor II H antibody
    • Transcription factor IIH 52 kDa subunit antibody
    see all

Images

  • PFA-fixed, Triton X-100 permeabilized U-2 OS (human bone osteosarcoma epithelial cell line) cells stained for GTF2H4 (green) using ab221999 at 4 µg/ml in ICC/IF.

References

ab221999 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab221999.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up